Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   QCM40_RS02320 Genome accession   NZ_CP122516
Coordinates   457904..458029 (+) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   -
Organism   Helicobacter pylori strain HP34     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 452904..463029
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QCM40_RS02295 (QCM40_02295) - 452957..455182 (+) 2226 WP_279955852.1 ATP-dependent Clp protease ATP-binding subunit -
  QCM40_RS02300 (QCM40_02300) panD 455172..455525 (+) 354 WP_120911231.1 aspartate 1-decarboxylase -
  QCM40_RS02305 (QCM40_02305) - 455528..455821 (+) 294 WP_048944407.1 YbaB/EbfC family nucleoid-associated protein -
  QCM40_RS02310 (QCM40_02310) - 455821..456825 (+) 1005 WP_279956553.1 PDZ domain-containing protein -
  QCM40_RS02315 (QCM40_02315) comB6 456833..457888 (+) 1056 WP_279956554.1 P-type conjugative transfer protein TrbL Machinery gene
  QCM40_RS02320 (QCM40_02320) comB7 457904..458029 (+) 126 WP_001217874.1 hypothetical protein Machinery gene
  QCM40_RS02325 (QCM40_02325) comB8 458026..458769 (+) 744 WP_058338730.1 virB8 family protein Machinery gene
  QCM40_RS02330 (QCM40_02330) comB9 458769..459731 (+) 963 WP_279955853.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QCM40_RS02335 (QCM40_02335) comB10 459724..460854 (+) 1131 WP_279955854.1 DNA type IV secretion system protein ComB10 Machinery gene
  QCM40_RS02340 (QCM40_02340) - 460924..462336 (+) 1413 WP_279955855.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=740984 QCM40_RS02320 WP_001217874.1 457904..458029(+) (comB7) [Helicobacter pylori strain HP34]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=740984 QCM40_RS02320 WP_001217874.1 457904..458029(+) (comB7) [Helicobacter pylori strain HP34]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878