Detailed information
Bioinformatically predicted
Overview
| Name | comB2 | Type | Machinery gene |
| Locus tag | FOY54_RS02165 | Genome accession | NZ_AP019774 |
| Coordinates | 412780..413064 (+) | Length | 94 a.a. |
| NCBI ID | WP_064430199.1 | Uniprot ID | - |
| Organism | Helicobacter suis strain SNTW101c | ||
| Function | transformation-associated type IV transport system (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 404378..471839 | 412780..413064 | within | 0 |
Gene organization within MGE regions
Location: 404378..471839
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOY54_RS02110 (SNTW_04250) | - | 405185..405385 (+) | 201 | WP_064430190.1 | hypothetical protein | - |
| FOY54_RS02115 | tnpA | 405784..406214 (-) | 431 | Protein_428 | IS200/IS605 family transposase | - |
| FOY54_RS02120 (SNTW_04270) | - | 406329..406877 (-) | 549 | WP_064429994.1 | hypothetical protein | - |
| FOY54_RS02125 (SNTW_04280) | - | 407046..407312 (-) | 267 | WP_064429993.1 | helix-turn-helix domain-containing protein | - |
| FOY54_RS02130 (SNTW_04290) | - | 407309..408379 (-) | 1071 | WP_170221192.1 | site-specific integrase | - |
| FOY54_RS02135 | - | 408592..409388 (+) | 797 | Protein_432 | RNA-guided endonuclease TnpB family protein | - |
| FOY54_RS02140 (SNTW_04310) | - | 409374..410331 (-) | 958 | Protein_433 | aldo/keto reductase | - |
| FOY54_RS02145 (SNTW_04330) | - | 410402..410965 (-) | 564 | WP_064430201.1 | DapH/DapD/GlmU-related protein | - |
| FOY54_RS08910 (SNTW_04340) | - | 411003..411173 (-) | 171 | WP_143433415.1 | alpha/beta hydrolase | - |
| FOY54_RS02155 (SNTW_04350) | - | 411412..412200 (+) | 789 | WP_143433418.1 | integrase | - |
| FOY54_RS02160 (SNTW_04360) | - | 412304..412783 (+) | 480 | WP_015643439.1 | hypothetical protein | - |
| FOY54_RS02165 (SNTW_04370) | comB2 | 412780..413064 (+) | 285 | WP_064430199.1 | TrbC/VirB2 family protein | Machinery gene |
| FOY54_RS02170 (SNTW_04380) | comB3 | 413075..413338 (+) | 264 | WP_001177715.1 | hypothetical protein | Machinery gene |
| FOY54_RS02175 (SNTW_04390) | - | 413349..413585 (+) | 237 | WP_064430198.1 | hypothetical protein | - |
| FOY54_RS02180 (SNTW_04400) | - | 413585..416161 (+) | 2577 | WP_064430197.1 | VirB4 family type IV secretion/conjugal transfer ATPase | - |
| FOY54_RS02185 | - | 416163..416297 (+) | 135 | WP_000738747.1 | hypothetical protein | - |
| FOY54_RS02190 (SNTW_04410) | - | 416290..417459 (+) | 1170 | WP_064430196.1 | type IV secretion system protein | - |
| FOY54_RS02195 (SNTW_04420) | - | 417456..419123 (+) | 1668 | WP_064430195.1 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| FOY54_RS02200 (SNTW_04430) | comB10 | 419120..420322 (+) | 1203 | WP_064430194.1 | DNA type IV secretion system protein ComB10 | Machinery gene |
| FOY54_RS02205 (SNTW_04440) | - | 420306..422555 (+) | 2250 | WP_064430193.1 | collagen-like protein | - |
| FOY54_RS02210 (SNTW_04450) | - | 422568..423545 (+) | 978 | WP_064430192.1 | hypothetical protein | - |
| FOY54_RS02215 (SNTW_04460) | - | 423563..423817 (+) | 255 | WP_176485824.1 | hypothetical protein | - |
| FOY54_RS02220 (SNTW_04470) | - | 423822..424766 (+) | 945 | WP_006564526.1 | CpaF/VirB11 family protein | - |
| FOY54_RS02225 (SNTW_04480) | - | 424763..425282 (+) | 520 | Protein_450 | replication regulatory RepB family protein | - |
| FOY54_RS02230 (SNTW_04490) | - | 425279..426381 (+) | 1103 | Protein_451 | type IV secretory system conjugative DNA transfer family protein | - |
| FOY54_RS02235 (SNTW_04510) | - | 426436..427516 (-) | 1081 | Protein_452 | RNA-guided endonuclease InsQ/TnpB family protein | - |
| FOY54_RS02240 (SNTW_04520) | tnpA | 427488..427952 (-) | 465 | Protein_453 | IS200/IS605 family transposase | - |
| FOY54_RS02245 (SNTW_04530) | - | 428070..429236 (+) | 1167 | Protein_454 | type IV secretory system conjugative DNA transfer family protein | - |
| FOY54_RS09505 (SNTW_04540) | - | 429256..430338 (+) | 1083 | WP_064429950.1 | hypothetical protein | - |
| FOY54_RS09080 (SNTW_04550) | - | 430375..430695 (+) | 321 | WP_006564537.1 | hypothetical protein | - |
| FOY54_RS02260 (SNTW_04560) | - | 430708..432768 (+) | 2061 | WP_064429949.1 | type IA DNA topoisomerase | - |
| FOY54_RS02265 (SNTW_04570) | - | 432823..433293 (+) | 471 | WP_000965788.1 | hypothetical protein | - |
| FOY54_RS02270 (SNTW_04580) | - | 433263..434066 (+) | 804 | WP_064429948.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| FOY54_RS02275 (SNTW_04590) | - | 434140..434805 (-) | 666 | WP_064429947.1 | hypothetical protein | - |
| FOY54_RS02280 (SNTW_04600) | - | 434783..435151 (-) | 369 | WP_021305613.1 | hypothetical protein | - |
| FOY54_RS02285 (SNTW_04610) | - | 435198..435866 (-) | 669 | WP_064429946.1 | ParA family protein | - |
| FOY54_RS02290 (SNTW_04620) | - | 436410..437462 (+) | 1053 | WP_001980594.1 | ArdC family protein | - |
| FOY54_RS02295 (SNTW_04630) | - | 437462..439318 (+) | 1857 | WP_196757951.1 | hypothetical protein | - |
| FOY54_RS02300 (SNTW_04640) | - | 439328..440761 (+) | 1434 | WP_064429944.1 | hypothetical protein | - |
| FOY54_RS02305 (SNTW_04650) | - | 440761..441999 (+) | 1239 | WP_064429943.1 | type IV secretion system protein | - |
| FOY54_RS02310 (SNTW_04660) | - | 442011..443252 (+) | 1242 | WP_064429942.1 | hypothetical protein | - |
| FOY54_RS02315 (SNTW_04670) | - | 443256..443903 (-) | 648 | WP_064429941.1 | hypothetical protein | - |
| FOY54_RS02320 | - | 444166..444591 (+) | 426 | Protein_469 | CAAX protease | - |
| FOY54_RS02325 | - | 444631..444882 (+) | 252 | WP_000006537.1 | hypothetical protein | - |
| FOY54_RS02330 (SNTW_04690) | - | 445022..445657 (+) | 636 | WP_415270436.1 | hypothetical protein | - |
| FOY54_RS02335 (SNTW_04700) | - | 445975..447042 (-) | 1068 | WP_064429940.1 | tyrosine-type recombinase/integrase | - |
| FOY54_RS02340 (SNTW_04710) | - | 448141..450129 (-) | 1989 | WP_196757950.1 | relaxase/mobilization nuclease domain-containing protein | - |
| FOY54_RS09365 | - | 451087..451218 (-) | 132 | WP_256623997.1 | hypothetical protein | - |
| FOY54_RS08725 (SNTW_04730) | - | 451339..451518 (-) | 180 | WP_064429938.1 | hypothetical protein | - |
| FOY54_RS08730 (SNTW_04740) | - | 451505..451753 (-) | 249 | WP_050780202.1 | hypothetical protein | - |
| FOY54_RS02350 (SNTW_04750) | - | 451964..452320 (-) | 357 | WP_064429937.1 | hypothetical protein | - |
| FOY54_RS02355 | - | 452657..452833 (-) | 177 | Protein_478 | DUF262 domain-containing protein | - |
| FOY54_RS02365 (SNTW_04760) | napA | 455071..457896 (+) | 2826 | WP_064429936.1 | periplasmic nitrate reductase subunit alpha | - |
| FOY54_RS02370 (SNTW_04770) | napG | 457898..458656 (+) | 759 | WP_034376280.1 | ferredoxin-type protein NapG | - |
| FOY54_RS02375 (SNTW_04780) | napH | 458656..459450 (+) | 795 | WP_034376278.1 | quinol dehydrogenase ferredoxin subunit NapH | - |
| FOY54_RS08920 (SNTW_04790) | - | 459493..460308 (+) | 816 | WP_196757948.1 | PAS domain-containing protein | - |
| FOY54_RS08925 (SNTW_04800) | - | 460298..460558 (+) | 261 | WP_034376274.1 | hypothetical protein | - |
| FOY54_RS09085 (SNTW_04810) | - | 460629..460823 (+) | 195 | Protein_484 | methyl-accepting chemotaxis protein | - |
| FOY54_RS02385 (SNTW_04820) | - | 461146..462435 (+) | 1290 | WP_231102832.1 | SLC13 family permease | - |
| FOY54_RS02390 (SNTW_04830) | - | 462400..463398 (-) | 999 | WP_006564541.1 | restriction endonuclease subunit S | - |
| FOY54_RS02395 (SNTW_04840) | - | 463383..466085 (+) | 2703 | WP_006564540.1 | UvrD-helicase domain-containing protein | - |
| FOY54_RS02400 (SNTW_04850) | nhaA | 466088..467401 (+) | 1314 | WP_176485110.1 | sodium/proton antiporter NhaA | - |
| FOY54_RS02405 (SNTW_04860) | yajC | 467445..467759 (+) | 315 | WP_034376267.1 | preprotein translocase subunit YajC | - |
| FOY54_RS02410 (SNTW_04870) | secD | 467766..469376 (+) | 1611 | WP_176485111.1 | protein translocase subunit SecD | - |
| FOY54_RS02415 (SNTW_04880) | secF | 469363..470328 (+) | 966 | WP_006564545.1 | protein translocase subunit SecF | - |
| FOY54_RS02420 (SNTW_04890) | - | 470347..470688 (+) | 342 | WP_064429935.1 | DUF6394 family protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10666.96 Da Isoelectric Point: 10.9123
>NTDB_id=73922 FOY54_RS02165 WP_064430199.1 412780..413064(+) (comB2) [Helicobacter suis strain SNTW101c]
MKKLSHFRKLIAFLGFSPPLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
MKKLSHFRKLIAFLGFSPPLLQADMTTFFNSIEQQLTSPTAKGILMVIFLGLAIFIWKNLDRWKEILMTVLAIAIGAAIF
FKAPALANWFMSIF
Nucleotide
Download Length: 285 bp
>NTDB_id=73922 FOY54_RS02165 WP_064430199.1 412780..413064(+) (comB2) [Helicobacter suis strain SNTW101c]
ATGAAAAAATTAAGTCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACCTTTATTACAAGCGGATATGACTAC
CTTTTTTAATAGCATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTCATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGCGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
ATGAAAAAATTAAGTCATTTTAGAAAGCTCATCGCCTTTTTAGGTTTTTCACCACCTTTATTACAAGCGGATATGACTAC
CTTTTTTAATAGCATTGAACAACAACTCACTAGCCCCACCGCTAAGGGTATTTTGATGGTCATTTTTTTAGGGCTTGCTA
TTTTCATATGGAAAAATTTAGACAGATGGAAAGAAATCTTAATGACAGTCCTTGCTATTGCCATAGGCGCTGCAATCTTT
TTTAAAGCCCCAGCCTTAGCTAATTGGTTTATGAGTATTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comB2 | Helicobacter pylori 26695 |
57.143 |
96.809 |
0.553 |