Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   K6J99_RS13120 Genome accession   NZ_AP024623
Coordinates   2521044..2521217 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain BEST3102     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2516044..2526217
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K6J99_RS13105 (BsBEST3102_25050) gcvT 2516843..2517931 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  K6J99_RS13110 (BsBEST3102_25060) hepAA 2518373..2520046 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  K6J99_RS13115 (BsBEST3102_25070) yqhG 2520067..2520861 (+) 795 WP_003230200.1 YqhG family protein -
  K6J99_RS13120 (BsBEST3102_25080) sinI 2521044..2521217 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  K6J99_RS13125 (BsBEST3102_25090) sinR 2521251..2521586 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  K6J99_RS13130 (BsBEST3102_25100) tasA 2521679..2522464 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  K6J99_RS13135 (BsBEST3102_25110) sipW 2522528..2523100 (-) 573 WP_003246088.1 signal peptidase I SipW -
  K6J99_RS13140 (BsBEST3102_25120) tapA 2523084..2523845 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  K6J99_RS13145 (BsBEST3102_25130) yqzG 2524117..2524443 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  K6J99_RS13150 (BsBEST3102_25140) spoIITA 2524485..2524664 (-) 180 WP_003230176.1 YqzE family protein -
  K6J99_RS13155 (BsBEST3102_25150) comGG 2524735..2525109 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  K6J99_RS13160 (BsBEST3102_25160) comGF 2525110..2525493 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  K6J99_RS13165 (BsBEST3102_25170) comGE 2525519..2525866 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=73887 K6J99_RS13120 WP_003230187.1 2521044..2521217(+) (sinI) [Bacillus subtilis strain BEST3102]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=73887 K6J99_RS13120 WP_003230187.1 2521044..2521217(+) (sinI) [Bacillus subtilis strain BEST3102]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment