Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   OF864_RS14145 Genome accession   NZ_CP106987
Coordinates   2775995..2776273 (+) Length   92 a.a.
NCBI ID   WP_110496281.1    Uniprot ID   -
Organism   Bacillus cereus strain IBA1     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Genomic Context

Location: 2770995..2781273
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OF864_RS14095 (OF864_14100) - 2771186..2771374 (+) 189 WP_283503113.1 helix-turn-helix domain-containing protein -
  OF864_RS14100 (OF864_14105) - 2771398..2771553 (+) 156 WP_283503114.1 hypothetical protein -
  OF864_RS14105 (OF864_14110) - 2771591..2772405 (+) 815 Protein_2708 ORF6C domain-containing protein -
  OF864_RS14110 (OF864_14115) - 2772568..2772881 (+) 314 Protein_2709 hypothetical protein -
  OF864_RS14115 (OF864_14120) - 2772991..2773167 (+) 177 WP_283503115.1 hypothetical protein -
  OF864_RS14120 (OF864_14125) - 2773173..2774057 (+) 885 WP_283503116.1 phage replisome organizer N-terminal domain-containing protein -
  OF864_RS14125 (OF864_14130) - 2774072..2774986 (+) 915 WP_283503117.1 AAA family ATPase -
  OF864_RS14130 (OF864_14135) - 2774999..2775193 (+) 195 Protein_2713 hypothetical protein -
  OF864_RS14135 (OF864_14140) - 2775210..2775620 (+) 411 WP_283503118.1 hypothetical protein -
  OF864_RS14140 (OF864_14145) - 2775653..2775907 (-) 255 WP_149290131.1 hypothetical protein -
  OF864_RS14145 (OF864_14150) abrB 2775995..2776273 (+) 279 WP_110496281.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  OF864_RS14150 (OF864_14155) - 2776266..2776625 (+) 360 WP_110496283.1 cell division protein SepF -
  OF864_RS14155 (OF864_14160) - 2776645..2776809 (+) 165 WP_050842983.1 DUF3954 domain-containing protein -
  OF864_RS14160 (OF864_14165) - 2776837..2777088 (+) 252 WP_042991632.1 hypothetical protein -
  OF864_RS14165 (OF864_14170) - 2777108..2777617 (+) 510 WP_283503119.1 dUTP diphosphatase -
  OF864_RS14170 (OF864_14175) - 2777805..2778002 (+) 198 WP_283503120.1 hypothetical protein -
  OF864_RS14175 (OF864_14180) - 2778162..2778353 (+) 192 WP_283503121.1 hypothetical protein -
  OF864_RS14180 (OF864_14185) - 2778370..2778744 (+) 375 WP_283503122.1 hypothetical protein -
  OF864_RS14185 (OF864_14190) - 2778782..2779066 (+) 285 WP_283503123.1 hypothetical protein -
  OF864_RS14190 (OF864_14195) - 2779100..2779321 (+) 222 WP_283503124.1 hypothetical protein -
  OF864_RS14195 (OF864_14200) - 2779364..2779594 (+) 231 WP_283503125.1 hypothetical protein -
  OF864_RS14200 (OF864_14205) - 2779843..2780034 (+) 192 WP_283503126.1 hypothetical protein -
  OF864_RS14205 (OF864_14210) - 2780169..2780300 (+) 132 WP_283503127.1 DUF3983 domain-containing protein -
  OF864_RS14210 (OF864_14215) - 2780406..2780576 (+) 171 WP_283503128.1 hypothetical protein -
  OF864_RS14215 (OF864_14220) - 2780597..2781067 (+) 471 WP_283503129.1 ArpU family phage packaging/lysis transcriptional regulator -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10013.58 Da        Isoelectric Point: 5.1693

>NTDB_id=736916 OF864_RS14145 WP_110496281.1 2775995..2776273(+) (abrB) [Bacillus cereus strain IBA1]
MKNTGVTRKVDELGRVVIPVELRRTLGIAEGTALDVHVDGENIVLRKPEKSCFVTGEVSESNIELLGGRMVLSKEGASEL
LDLLQKSVMEHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=736916 OF864_RS14145 WP_110496281.1 2775995..2776273(+) (abrB) [Bacillus cereus strain IBA1]
ATGAAAAATACAGGTGTTACAAGAAAAGTGGACGAGCTAGGTCGCGTAGTAATTCCAGTTGAGTTACGCAGAACTTTGGG
TATTGCTGAAGGGACAGCATTAGACGTTCATGTTGACGGAGAAAACATCGTTTTAAGAAAACCAGAAAAGTCATGTTTTG
TAACAGGTGAAGTGTCTGAATCCAACATCGAATTGTTAGGCGGCCGAATGGTTTTGAGTAAGGAAGGGGCAAGTGAGTTA
TTGGACCTTCTTCAAAAGAGTGTGATGGAACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-50)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

60

97.826

0.587