Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   FNL60_RS06075 Genome accession   NZ_AP019720
Coordinates   1179001..1179435 (-) Length   144 a.a.
NCBI ID   WP_002263292.1    Uniprot ID   A0AAX1K4B8
Organism   Streptococcus mutans strain NBRC 13955     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1175451..1210507 1179001..1179435 within 0


Gene organization within MGE regions


Location: 1175451..1210507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNL60_RS06065 (SM3g_11190) rcrQ 1175451..1177205 (-) 1755 WP_002280030.1 ABC transporter ATP-binding protein Regulator
  FNL60_RS06070 (SM3g_11200) rcrP 1177195..1178997 (-) 1803 WP_002280031.1 ABC transporter ATP-binding protein Regulator
  FNL60_RS06075 (SM3g_11210) rcrR 1179001..1179435 (-) 435 WP_002263292.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  FNL60_RS06080 (SM3g_11220) queC 1179987..1180640 (+) 654 WP_002263291.1 7-cyano-7-deazaguanine synthase QueC -
  FNL60_RS06085 (SM3g_11230) queD 1180640..1181086 (+) 447 WP_002263290.1 6-carboxytetrahydropterin synthase QueD -
  FNL60_RS06090 (SM3g_11240) queE 1181083..1181799 (+) 717 WP_002263289.1 7-carboxy-7-deazaguanine synthase QueE -
  FNL60_RS06095 (SM3g_11250) queF 1181812..1182300 (+) 489 WP_002280032.1 preQ(1) synthase -
  FNL60_RS06100 (SM3g_11260) - 1182409..1182792 (+) 384 WP_002265142.1 DUF3021 family protein -
  FNL60_RS06105 (SM3g_11270) gdhA 1182904..1184253 (-) 1350 WP_002280033.1 NADP-specific glutamate dehydrogenase -
  FNL60_RS06110 (SM3g_11280) - 1184900..1185409 (+) 510 WP_002262901.1 DUF308 domain-containing protein -
  FNL60_RS06115 (SM3g_11290) gtfD 1185581..1189969 (-) 4389 WP_002280370.1 glucosyltransferase-S -
  FNL60_RS06120 (SM3g_11300) - 1190190..1191110 (-) 921 WP_002280369.1 AEC family transporter -
  FNL60_RS06125 (SM3g_11310) - 1191226..1192998 (-) 1773 WP_002280368.1 ABC transporter ATP-binding protein -
  FNL60_RS06130 (SM3g_11320) - 1193009..1194745 (-) 1737 WP_002280367.1 ABC transporter ATP-binding protein -
  FNL60_RS06135 (SM3g_11330) - 1195202..1197070 (-) 1869 WP_002280366.1 ABC-F family ATP-binding cassette domain-containing protein -
  FNL60_RS06140 (SM3g_11340) - 1197073..1198278 (-) 1206 WP_002266717.1 CCA tRNA nucleotidyltransferase -
  FNL60_RS06145 (SM3g_11350) dapB 1198275..1199042 (-) 768 WP_002262893.1 4-hydroxy-tetrahydrodipicolinate reductase -
  FNL60_RS06150 (SM3g_11360) - 1199054..1199899 (-) 846 WP_002266545.1 DegV family protein -
  FNL60_RS06155 (SM3g_11370) - 1199905..1200279 (-) 375 WP_002262891.1 DUF1149 family protein -
  FNL60_RS06160 - 1200388..1201929 (-) 1542 WP_002280365.1 hypothetical protein -
  FNL60_RS06165 (SM3g_11400) - 1201916..1202632 (-) 717 WP_002265102.1 ABC transporter ATP-binding protein -
  FNL60_RS06170 (SM3g_11410) - 1202707..1203312 (-) 606 WP_002280364.1 TetR/AcrR family transcriptional regulator -
  FNL60_RS06175 - 1203475..1203978 (-) 504 WP_002280363.1 phosphatase PAP2 family protein -
  FNL60_RS06180 (SM3g_11430) - 1204219..1205298 (-) 1080 WP_002262882.1 serine hydrolase domain-containing protein -
  FNL60_RS06185 (SM3g_11440) galE 1205564..1206565 (-) 1002 WP_002269393.1 UDP-glucose 4-epimerase GalE -
  FNL60_RS06190 (SM3g_11450) galT 1206714..1208189 (-) 1476 WP_002280362.1 UDP-glucose--hexose-1-phosphate uridylyltransferase -
  FNL60_RS06195 (SM3g_11460) - 1208194..1209366 (-) 1173 WP_002280361.1 galactokinase -
  FNL60_RS06200 (SM3g_11470) - 1209509..1210507 (+) 999 WP_002280360.1 LacI family DNA-binding transcriptional regulator -

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 16720.58 Da        Isoelectric Point: 10.5126

>NTDB_id=73534 FNL60_RS06075 WP_002263292.1 1179001..1179435(-) (rcrR) [Streptococcus mutans strain NBRC 13955]
MKEPFSEFKNLITATERYIQELSKSHGVEHLSGPQGWTVMFLKDNQGKEIFIKDIEKRLDISKSVTSNLIKRMEKNGFIS
VIPSRKDRRYKQIVLTPLGQEKAGKITVFLTDLKKLLLKDISQEDLSVARKVFKQIKQNLEKKE

Nucleotide


Download         Length: 435 bp        

>NTDB_id=73534 FNL60_RS06075 WP_002263292.1 1179001..1179435(-) (rcrR) [Streptococcus mutans strain NBRC 13955]
ATGAAGGAGCCTTTTAGTGAATTTAAAAACCTCATTACAGCAACAGAAAGATATATTCAAGAATTATCCAAAAGCCATGG
TGTTGAACATCTGTCCGGACCTCAGGGATGGACAGTTATGTTTTTAAAGGATAATCAAGGAAAGGAAATTTTTATTAAAG
ATATTGAAAAAAGGTTAGATATCTCAAAATCTGTGACCAGTAATCTCATTAAACGAATGGAAAAAAATGGTTTTATTTCT
GTTATTCCTTCCAGAAAAGACAGACGATACAAGCAAATTGTTTTAACGCCATTAGGTCAGGAAAAAGCTGGAAAAATAAC
TGTTTTTTTAACAGATCTTAAAAAGTTGCTTCTAAAAGATATTAGTCAGGAAGACTTATCAGTTGCTCGGAAGGTTTTTA
AACAAATCAAACAAAATTTAGAAAAGAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(31-89)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

100

100

1

Multiple sequence alignment