Detailed information
Bioinformatically predicted
Overview
| Name | pilV | Type | Machinery gene |
| Locus tag | LLE32_RS02345 | Genome accession | NZ_CP106775 |
| Coordinates | 452231..452842 (+) | Length | 203 a.a. |
| NCBI ID | WP_003699626.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10702 | ||
| Function | repress natural transformation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 440051..506474 | 452231..452842 | within | 0 |
Gene organization within MGE regions
Location: 440051..506474
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE32_RS02285 (LLE32_02285) | - | 440051..441034 (+) | 984 | WP_003687900.1 | ribose-phosphate pyrophosphokinase | - |
| LLE32_RS02290 (LLE32_02290) | - | 441101..441673 (+) | 573 | WP_003687901.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| LLE32_RS02295 (LLE32_02295) | - | 441799..442968 (-) | 1170 | WP_003687902.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| LLE32_RS02300 (LLE32_02300) | ilvA | 443117..444643 (+) | 1527 | WP_003687904.1 | threonine ammonia-lyase, biosynthetic | - |
| LLE32_RS02305 (LLE32_02305) | - | 444699..445775 (-) | 1077 | WP_003692814.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| LLE32_RS02310 (LLE32_02310) | cysW | 445772..446632 (-) | 861 | WP_003699617.1 | sulfate ABC transporter permease subunit CysW | - |
| LLE32_RS02315 (LLE32_02315) | cysT | 446821..447648 (-) | 828 | WP_003699619.1 | sulfate ABC transporter permease subunit CysT | - |
| LLE32_RS02320 (LLE32_02320) | - | 447829..448161 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| LLE32_RS02325 (LLE32_02325) | - | 448488..448997 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| LLE32_RS02330 (LLE32_02330) | - | 449229..449810 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| LLE32_RS02335 (LLE32_02335) | dnaB | 449974..451380 (+) | 1407 | WP_003699622.1 | replicative DNA helicase | - |
| LLE32_RS02340 (LLE32_02340) | pilH | 451534..452199 (+) | 666 | WP_003699624.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| LLE32_RS02345 (LLE32_02345) | pilV | 452231..452842 (+) | 612 | WP_003699626.1 | type IV pilus modification protein PilV | Machinery gene |
| LLE32_RS02350 (LLE32_02350) | pilJ | 452839..453789 (+) | 951 | WP_229433524.1 | PilW family protein | Machinery gene |
| LLE32_RS02355 (LLE32_02355) | pilK | 453768..454379 (+) | 612 | WP_229433526.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| LLE32_RS02360 (LLE32_02360) | pilL | 454381..454854 (+) | 474 | WP_172760650.1 | PilX family type IV pilin | Machinery gene |
| LLE32_RS02365 (LLE32_02365) | - | 454924..455232 (-) | 309 | WP_025456177.1 | AzlD family protein | - |
| LLE32_RS02370 (LLE32_02370) | - | 455229..455939 (-) | 711 | Protein_464 | AzlC family ABC transporter permease | - |
| LLE32_RS02375 (LLE32_02375) | dut | 456105..456557 (+) | 453 | WP_003699637.1 | dUTP diphosphatase | - |
| LLE32_RS02380 (LLE32_02380) | dapC | 456633..457820 (+) | 1188 | WP_003699639.1 | succinyldiaminopimelate transaminase | - |
| LLE32_RS02385 (LLE32_02385) | yaaA | 457976..458755 (+) | 780 | WP_003699641.1 | peroxide stress protein YaaA | - |
| LLE32_RS02400 (LLE32_02400) | - | 459285..460478 (+) | 1194 | WP_017146746.1 | phage integrase central domain-containing protein | - |
| LLE32_RS02405 (LLE32_02405) | - | 460834..461103 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| LLE32_RS02410 (LLE32_02410) | - | 461298..461981 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| LLE32_RS11770 | - | 462262..462528 (-) | 267 | Protein_471 | hypothetical protein | - |
| LLE32_RS02420 (LLE32_02420) | - | 462639..462854 (-) | 216 | WP_260283716.1 | hypothetical protein | - |
| LLE32_RS02430 (LLE32_02430) | - | 462906..463395 (-) | 490 | Protein_473 | siphovirus Gp157 family protein | - |
| LLE32_RS02435 (LLE32_02435) | - | 463392..463532 (-) | 141 | WP_263059778.1 | hypothetical protein | - |
| LLE32_RS11925 | - | 463878..464153 (-) | 276 | WP_396954015.1 | phage replication initiation protein, NGO0469 family | - |
| LLE32_RS02445 (LLE32_02445) | - | 464036..464389 (-) | 354 | WP_263059780.1 | hypothetical protein | - |
| LLE32_RS02450 (LLE32_02450) | - | 464458..464619 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| LLE32_RS02455 (LLE32_02455) | - | 464616..464891 (-) | 276 | WP_033911205.1 | NGO1622 family putative holin | - |
| LLE32_RS02465 (LLE32_02465) | - | 465043..465372 (-) | 330 | Protein_479 | hypothetical protein | - |
| LLE32_RS02470 (LLE32_02470) | - | 465514..465819 (-) | 306 | WP_229433405.1 | hypothetical protein | - |
| LLE32_RS02475 (LLE32_02475) | - | 465816..466292 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| LLE32_RS02480 (LLE32_02480) | - | 466323..466523 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| LLE32_RS02485 (LLE32_02485) | - | 467007..467225 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| LLE32_RS02490 (LLE32_02490) | - | 467242..467601 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| LLE32_RS02495 (LLE32_02495) | - | 467602..468141 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| LLE32_RS02500 (LLE32_02500) | - | 468301..469017 (-) | 717 | WP_003695999.1 | helix-turn-helix transcriptional regulator | - |
| LLE32_RS02505 (LLE32_02505) | - | 469398..469625 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| LLE32_RS02510 (LLE32_02510) | - | 469743..470807 (+) | 1065 | WP_003689134.1 | hypothetical protein | - |
| LLE32_RS02515 (LLE32_02515) | - | 470804..472165 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| LLE32_RS02520 (LLE32_02520) | - | 472202..472465 (+) | 264 | WP_154230797.1 | hypothetical protein | - |
| LLE32_RS02525 (LLE32_02525) | - | 472504..472998 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| LLE32_RS02530 (LLE32_02530) | - | 473175..473324 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| LLE32_RS02535 (LLE32_02535) | - | 473352..473633 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| LLE32_RS02540 (LLE32_02540) | - | 473624..474004 (+) | 381 | WP_033910829.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLE32_RS02545 (LLE32_02545) | - | 474271..474678 (+) | 408 | WP_003691430.1 | hypothetical protein | - |
| LLE32_RS02550 (LLE32_02550) | - | 474769..475929 (+) | 1161 | WP_003691428.1 | type I restriction endonuclease | - |
| LLE32_RS02555 (LLE32_02555) | - | 476211..477080 (+) | 870 | WP_003700071.1 | BRO family protein | - |
| LLE32_RS02560 (LLE32_02560) | - | 477373..477822 (+) | 450 | WP_229433404.1 | hypothetical protein | - |
| LLE32_RS02565 (LLE32_02565) | terL | 477884..479305 (+) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| LLE32_RS02570 (LLE32_02570) | - | 479302..481449 (+) | 2148 | WP_003691423.1 | phage portal protein | - |
| LLE32_RS02575 (LLE32_02575) | - | 481517..482674 (+) | 1158 | WP_003700068.1 | hypothetical protein | - |
| LLE32_RS02580 (LLE32_02580) | - | 482715..484214 (+) | 1500 | WP_003691419.1 | hypothetical protein | - |
| LLE32_RS02585 (LLE32_02585) | - | 484221..484583 (+) | 363 | WP_003689082.1 | hypothetical protein | - |
| LLE32_RS02590 (LLE32_02590) | - | 484586..485116 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| LLE32_RS02595 (LLE32_02595) | - | 485116..485598 (+) | 483 | WP_003706029.1 | HK97 gp10 family phage protein | - |
| LLE32_RS02600 (LLE32_02600) | - | 485595..486023 (+) | 429 | WP_003697213.1 | hypothetical protein | - |
| LLE32_RS02605 (LLE32_02605) | - | 486049..486822 (+) | 774 | WP_003691416.1 | hypothetical protein | - |
| LLE32_RS02610 (LLE32_02610) | - | 486884..487213 (+) | 330 | WP_003689072.1 | hypothetical protein | - |
| LLE32_RS02615 (LLE32_02615) | - | 487225..487491 (+) | 267 | WP_003692873.1 | hypothetical protein | - |
| LLE32_RS02620 (LLE32_02620) | - | 487491..488090 (+) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| LLE32_RS02625 (LLE32_02625) | - | 488087..488941 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| LLE32_RS02630 (LLE32_02630) | - | 488943..489374 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| LLE32_RS02635 (LLE32_02635) | - | 489402..489680 (-) | 279 | WP_003692877.1 | helix-turn-helix domain-containing protein | - |
| LLE32_RS02640 (LLE32_02640) | - | 489920..494065 (+) | 4146 | WP_025456199.1 | phage tail protein | - |
| LLE32_RS02645 (LLE32_02645) | - | 494177..494482 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| LLE32_RS02650 (LLE32_02650) | - | 494553..495023 (+) | 471 | WP_003691410.1 | hypothetical protein | - |
| LLE32_RS02655 (LLE32_02655) | - | 495024..495356 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| LLE32_RS02660 (LLE32_02660) | - | 495724..496071 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LLE32_RS02665 (LLE32_02665) | - | 496071..496307 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| LLE32_RS02670 (LLE32_02670) | - | 496514..497053 (+) | 540 | WP_047951643.1 | TIGR02594 family protein | - |
| LLE32_RS02675 (LLE32_02675) | - | 497053..497211 (+) | 159 | WP_003691816.1 | hypothetical protein | - |
| LLE32_RS02680 (LLE32_02680) | - | 497195..497536 (+) | 342 | WP_003700102.1 | hypothetical protein | - |
| LLE32_RS02685 (LLE32_02685) | - | 497520..497693 (+) | 174 | WP_003705498.1 | hypothetical protein | - |
| LLE32_RS02690 (LLE32_02690) | - | 498007..498156 (+) | 150 | WP_003689043.1 | hypothetical protein | - |
| LLE32_RS02695 (LLE32_02695) | - | 498186..501233 (+) | 3048 | WP_003700052.1 | tape measure protein | - |
| LLE32_RS02700 (LLE32_02700) | - | 501293..501772 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| LLE32_RS02705 (LLE32_02705) | - | 502111..503100 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| LLE32_RS02710 (LLE32_02710) | - | 503360..503548 (-) | 189 | WP_003689039.1 | hypothetical protein | - |
| LLE32_RS02715 (LLE32_02715) | purM | 503789..504823 (+) | 1035 | WP_003692893.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| LLE32_RS02720 (LLE32_02720) | - | 505821..506474 (+) | 654 | WP_229433403.1 | IS1595 family transposase | - |
Sequence
Protein
Download Length: 203 a.a. Molecular weight: 21997.01 Da Isoelectric Point: 5.0177
>NTDB_id=734875 LLE32_RS02345 WP_003699626.1 452231..452842(+) (pilV) [Neisseria gonorrhoeae strain 10702]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDLDSNKKN
YSLYMGKQTPSAVDGKFTLDAEKSKAQLAEEQLKRFSYELKNALPDAVGIHYAVCKDSSGNEPTLSDSGVFSSNCDNKAN
GDTLIKVLWVNDSAGDSDISRTNLGVSGGNIVYTYQARVGGRE
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDLDSNKKN
YSLYMGKQTPSAVDGKFTLDAEKSKAQLAEEQLKRFSYELKNALPDAVGIHYAVCKDSSGNEPTLSDSGVFSSNCDNKAN
GDTLIKVLWVNDSAGDSDISRTNLGVSGGNIVYTYQARVGGRE
Nucleotide
Download Length: 612 bp
>NTDB_id=734875 LLE32_RS02345 WP_003699626.1 452231..452842(+) (pilV) [Neisseria gonorrhoeae strain 10702]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGCTGATAGAAGTCTTGGTTGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTGCAGCTGCGGACGGTCGCTTCCGTCAGGGAAGCGGAGACGCAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTTGGATAGCAACAAGAAAAAC
TATAGTCTTTACATGGGAAAACAGACACCATCAGCTGTGGATGGTAAGTTTACGCTTGATGCCGAGAAAAGTAAGGCGCA
GTTGGCAGAGGAACAATTGAAGAGATTTAGTTATGAGCTGAAAAATGCCTTGCCGGATGCGGTCGGTATTCATTACGCCG
TCTGCAAGGATTCGTCGGGTAACGAGCCGACATTGTCCGACAGCGGTGTTTTTTCTTCAAATTGCGACAATAAGGCAAAC
GGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGGGGTGAG
CGGCGGCAATATCGTATATACTTATCAGGCAAGGGTCGGAGGTCGTGAATGA
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGCTGATAGAAGTCTTGGTTGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTGCAGCTGCGGACGGTCGCTTCCGTCAGGGAAGCGGAGACGCAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTTGGATAGCAACAAGAAAAAC
TATAGTCTTTACATGGGAAAACAGACACCATCAGCTGTGGATGGTAAGTTTACGCTTGATGCCGAGAAAAGTAAGGCGCA
GTTGGCAGAGGAACAATTGAAGAGATTTAGTTATGAGCTGAAAAATGCCTTGCCGGATGCGGTCGGTATTCATTACGCCG
TCTGCAAGGATTCGTCGGGTAACGAGCCGACATTGTCCGACAGCGGTGTTTTTTCTTCAAATTGCGACAATAAGGCAAAC
GGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGGGGTGAG
CGGCGGCAATATCGTATATACTTATCAGGCAAGGGTCGGAGGTCGTGAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilV | Neisseria meningitidis 8013 |
87.44 |
100 |
0.892 |
| pilI | Neisseria gonorrhoeae MS11 |
82.759 |
100 |
0.828 |
| pilV | Neisseria gonorrhoeae MS11 |
82.759 |
100 |
0.828 |