Detailed information
Overview
| Name | pilK | Type | Machinery gene |
| Locus tag | LLE35_RS02360 | Genome accession | NZ_CP106773 |
| Coordinates | 453490..454101 (+) | Length | 203 a.a. |
| NCBI ID | WP_033911077.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10562 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 444421..492920 | 453490..454101 | within | 0 |
Gene organization within MGE regions
Location: 444421..492920
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE35_RS02310 (LLE35_02300) | - | 444421..445497 (-) | 1077 | WP_229931480.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| LLE35_RS02315 (LLE35_02305) | cysW | 445494..446354 (-) | 861 | WP_003699617.1 | sulfate ABC transporter permease subunit CysW | - |
| LLE35_RS02320 (LLE35_02310) | cysT | 446543..447370 (-) | 828 | WP_003699619.1 | sulfate ABC transporter permease subunit CysT | - |
| LLE35_RS02325 (LLE35_02315) | - | 447551..447883 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| LLE35_RS02330 (LLE35_02320) | - | 448210..448719 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| LLE35_RS02335 (LLE35_02325) | - | 448951..449532 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| LLE35_RS02340 (LLE35_02330) | dnaB | 449696..451102 (+) | 1407 | WP_003699622.1 | replicative DNA helicase | - |
| LLE35_RS02345 (LLE35_02335) | pilH | 451256..451921 (+) | 666 | WP_229931479.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| LLE35_RS02350 (LLE35_02340) | pilV | 451953..452564 (+) | 612 | WP_003699626.1 | type IV pilus modification protein PilV | Machinery gene |
| LLE35_RS02355 (LLE35_02345) | pilJ | 452561..453511 (+) | 951 | WP_003699627.1 | PilW family protein | Machinery gene |
| LLE35_RS02360 (LLE35_02350) | pilK | 453490..454101 (+) | 612 | WP_033911077.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| LLE35_RS02365 (LLE35_02355) | pilL | 454103..454576 (+) | 474 | WP_172760650.1 | PilX family type IV pilin | Machinery gene |
| LLE35_RS02370 (LLE35_02360) | - | 454646..454954 (-) | 309 | WP_025456177.1 | AzlD family protein | - |
| LLE35_RS02375 (LLE35_02365) | - | 454951..455661 (-) | 711 | Protein_466 | AzlC family ABC transporter permease | - |
| LLE35_RS02380 (LLE35_02370) | dut | 455827..456279 (+) | 453 | WP_003699637.1 | dUTP diphosphatase | - |
| LLE35_RS02385 (LLE35_02375) | dapC | 456355..457542 (+) | 1188 | WP_003699639.1 | succinyldiaminopimelate transaminase | - |
| LLE35_RS02390 (LLE35_02380) | yaaA | 457698..458477 (+) | 780 | WP_003699641.1 | peroxide stress protein YaaA | - |
| LLE35_RS02405 (LLE35_02395) | - | 459007..460200 (+) | 1194 | WP_017146746.1 | phage integrase central domain-containing protein | - |
| LLE35_RS02410 (LLE35_02400) | - | 460556..460825 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| LLE35_RS02415 (LLE35_02405) | - | 461020..461703 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| LLE35_RS11775 | - | 461984..462250 (-) | 267 | Protein_473 | hypothetical protein | - |
| LLE35_RS02425 (LLE35_02415) | - | 462361..462576 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| LLE35_RS02430 (LLE35_02420) | - | 462628..463119 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| LLE35_RS02435 (LLE35_02425) | - | 463116..463298 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE35_RS02440 (LLE35_02430) | - | 463438..464124 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| LLE35_RS02445 (LLE35_02435) | - | 464193..464354 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| LLE35_RS02450 (LLE35_02440) | - | 464351..464626 (-) | 276 | WP_033911205.1 | NGO1622 family putative holin | - |
| LLE35_RS02455 (LLE35_02445) | - | 464779..465111 (-) | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE35_RS02460 (LLE35_02450) | - | 465253..465546 (-) | 294 | WP_229931463.1 | hypothetical protein | - |
| LLE35_RS02465 (LLE35_02455) | - | 465543..466019 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| LLE35_RS02470 (LLE35_02460) | - | 466052..466252 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| LLE35_RS02475 (LLE35_02465) | - | 466736..466954 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| LLE35_RS02480 (LLE35_02470) | - | 466971..467330 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| LLE35_RS02485 (LLE35_02475) | - | 467331..467870 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| LLE35_RS02490 (LLE35_02480) | - | 468030..468746 (-) | 717 | WP_003695999.1 | helix-turn-helix transcriptional regulator | - |
| LLE35_RS02495 (LLE35_02485) | - | 469127..469354 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| LLE35_RS02500 (LLE35_02490) | - | 469472..469939 (+) | 468 | WP_229692802.1 | hypothetical protein | - |
| LLE35_RS02505 (LLE35_02495) | - | 470034..470537 (+) | 504 | WP_010360005.1 | hypothetical protein | - |
| LLE35_RS02510 (LLE35_02500) | - | 470534..471895 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| LLE35_RS02515 (LLE35_02505) | - | 471912..472142 (+) | 231 | WP_012503490.1 | hypothetical protein | - |
| LLE35_RS02520 (LLE35_02510) | - | 472233..472727 (+) | 495 | WP_047923539.1 | DUF3310 domain-containing protein | - |
| LLE35_RS02525 (LLE35_02515) | - | 472922..473071 (+) | 150 | WP_033911194.1 | phage associated protein | - |
| LLE35_RS02530 (LLE35_02520) | - | 473099..473380 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| LLE35_RS02535 (LLE35_02525) | - | 473350..473808 (+) | 459 | WP_263070563.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLE35_RS02540 (LLE35_02530) | - | 473801..474106 (+) | 306 | WP_025456182.1 | DUF1364 domain-containing protein | - |
| LLE35_RS02545 (LLE35_02535) | - | 474103..474486 (+) | 384 | WP_003699764.1 | recombination protein NinB | - |
| LLE35_RS02550 (LLE35_02540) | - | 474477..474995 (+) | 519 | WP_003693459.1 | HNH endonuclease | - |
| LLE35_RS02555 (LLE35_02545) | - | 475060..475482 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| LLE35_RS02560 (LLE35_02550) | - | 475482..476021 (+) | 540 | WP_003693457.1 | hypothetical protein | - |
| LLE35_RS02565 (LLE35_02555) | - | 476002..477276 (+) | 1275 | WP_309491694.1 | PBSX family phage terminase large subunit | - |
| LLE35_RS02570 (LLE35_02560) | - | 477261..479528 (+) | 2268 | WP_229433533.1 | hypothetical protein | - |
| LLE35_RS02575 (LLE35_02565) | - | 479766..480962 (+) | 1197 | WP_003693452.1 | hypothetical protein | - |
| LLE35_RS02580 (LLE35_02570) | - | 480959..488266 (+) | 7308 | WP_229931478.1 | PLxRFG domain-containing protein | - |
| LLE35_RS02585 (LLE35_02575) | - | 488892..490187 (+) | 1296 | WP_003693441.1 | DUF4043 family protein | - |
| LLE35_RS02590 (LLE35_02580) | - | 490245..490718 (+) | 474 | WP_003693439.1 | hypothetical protein | - |
| LLE35_RS02595 (LLE35_02585) | - | 490724..491209 (+) | 486 | WP_003693438.1 | hypothetical protein | - |
| LLE35_RS02600 (LLE35_02590) | - | 491206..491880 (+) | 675 | WP_003693436.1 | hypothetical protein | - |
| LLE35_RS02605 (LLE35_02595) | - | 491883..492032 (+) | 150 | WP_017146863.1 | hypothetical protein | - |
| LLE35_RS02610 (LLE35_02600) | - | 492069..492920 (-) | 852 | WP_003699775.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 203 a.a. Molecular weight: 22068.97 Da Isoelectric Point: 7.5813
>NTDB_id=734826 LLE35_RS02360 WP_033911077.1 453490..454101(+) (pilK) [Neisseria gonorrhoeae strain 10562]
MRKQNALTGIPTSDGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEAFGNIVVQGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYEKGTASVSKMP
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
MRKQNALTGIPTSDGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEAFGNIVVQGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYEKGTASVSKMP
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
Nucleotide
Download Length: 612 bp
>NTDB_id=734826 LLE35_RS02360 WP_033911077.1 453490..454101(+) (pilK) [Neisseria gonorrhoeae strain 10562]
ATGCGCAAACAGAACGCTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTTCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGTCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGCAAGGCAAGCCTACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATGAGAAAGGCACGGCAAGCGTCAGCAAAATGCCG
CGCTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
ATGCGCAAACAGAACGCTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTTCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGTCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGCAAGGCAAGCCTACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATGAGAAAGGCACGGCAAGCGTCAGCAAAATGCCG
CGCTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilK | Neisseria gonorrhoeae MS11 |
95.567 |
100 |
0.956 |