Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   FNP71_RS17375 Genome accession   NZ_AP019714
Coordinates   3252394..3252534 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain NBRC 13719     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3247394..3257534
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNP71_RS17350 (NBRC13719_32680) yuxO 3247707..3248087 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  FNP71_RS17355 (NBRC13719_32690) comA 3248106..3248750 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  FNP71_RS17360 comP 3248831..3251140 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  FNP71_RS17365 (NBRC13719_32720) comX 3251155..3251322 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  FNP71_RS17370 (NBRC13719_32730) comQ 3251310..3252209 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  FNP71_RS17375 (NBRC13719_32740) degQ 3252394..3252534 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  FNP71_RS17380 - 3252756..3252881 (+) 126 WP_003228793.1 hypothetical protein -
  FNP71_RS17385 (NBRC13719_32750) - 3252995..3253363 (+) 369 WP_003243784.1 hypothetical protein -
  FNP71_RS17390 (NBRC13719_32760) pdeH 3253339..3254568 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  FNP71_RS17395 (NBRC13719_32770) pncB 3254705..3256177 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  FNP71_RS17400 (NBRC13719_32780) pncA 3256193..3256744 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  FNP71_RS17405 (NBRC13719_32790) yueI 3256841..3257239 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=73458 FNP71_RS17375 WP_003220708.1 3252394..3252534(-) (degQ) [Bacillus subtilis subsp. subtilis strain NBRC 13719]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=73458 FNP71_RS17375 WP_003220708.1 3252394..3252534(-) (degQ) [Bacillus subtilis subsp. subtilis strain NBRC 13719]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment