Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | N7988_RS12670 | Genome accession | NZ_CP106675 |
| Coordinates | 2477302..2477580 (+) | Length | 92 a.a. |
| NCBI ID | WP_065704062.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain SRCM116293 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2466941..2512269 | 2477302..2477580 | within | 0 |
Gene organization within MGE regions
Location: 2466941..2512269
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7988_RS12595 (N7988_12595) | - | 2466941..2467204 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| N7988_RS12600 (N7988_12600) | - | 2467758..2468078 (+) | 321 | WP_001071364.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| N7988_RS12605 (N7988_12605) | - | 2468224..2468358 (+) | 135 | Protein_2410 | site-specific integrase | - |
| N7988_RS12610 (N7988_12610) | - | 2468568..2469053 (+) | 486 | WP_002063155.1 | hypothetical protein | - |
| N7988_RS12615 (N7988_12615) | - | 2469363..2470064 (+) | 702 | WP_000736195.1 | DUF3962 domain-containing protein | - |
| N7988_RS12620 (N7988_12620) | - | 2470103..2471212 (-) | 1110 | WP_000675852.1 | tyrosine-type recombinase/integrase | - |
| N7988_RS12625 (N7988_12625) | - | 2471516..2472754 (+) | 1239 | WP_065704072.1 | exosporium leader peptide-containing protein | - |
| N7988_RS12630 (N7988_12630) | - | 2473296..2474447 (+) | 1152 | WP_262314201.1 | AimR family lysis-lysogeny pheromone receptor | - |
| N7988_RS12635 (N7988_12635) | - | 2474485..2474631 (+) | 147 | WP_000720927.1 | hypothetical protein | - |
| N7988_RS12640 (N7988_12640) | - | 2474787..2474915 (+) | 129 | WP_255258933.1 | hypothetical protein | - |
| N7988_RS12645 (N7988_12645) | - | 2474953..2475306 (-) | 354 | WP_065704069.1 | helix-turn-helix transcriptional regulator | - |
| N7988_RS12650 (N7988_12650) | - | 2475507..2475698 (+) | 192 | WP_065704067.1 | helix-turn-helix transcriptional regulator | - |
| N7988_RS12655 (N7988_12655) | - | 2475755..2476021 (+) | 267 | WP_000522028.1 | helix-turn-helix domain-containing protein | - |
| N7988_RS12660 (N7988_12660) | - | 2476021..2476185 (+) | 165 | WP_000390285.1 | hypothetical protein | - |
| N7988_RS12665 (N7988_12665) | - | 2476243..2477298 (+) | 1056 | WP_065704065.1 | DnaD domain protein | - |
| N7988_RS12670 (N7988_12670) | abrB | 2477302..2477580 (+) | 279 | WP_065704062.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| N7988_RS12675 (N7988_12675) | - | 2477573..2477932 (+) | 360 | WP_065704060.1 | cell division protein SepF | - |
| N7988_RS12680 (N7988_12680) | - | 2477951..2478118 (+) | 168 | WP_000717825.1 | DUF3954 domain-containing protein | - |
| N7988_RS12685 (N7988_12685) | - | 2478144..2478395 (+) | 252 | WP_065704059.1 | hypothetical protein | - |
| N7988_RS12690 (N7988_12690) | - | 2478415..2478924 (+) | 510 | WP_065704057.1 | dUTP diphosphatase | - |
| N7988_RS12695 (N7988_12695) | - | 2479070..2479751 (-) | 682 | Protein_2428 | sulfotransferase family 2 domain-containing protein | - |
| N7988_RS12700 (N7988_12700) | - | 2481089..2481283 (-) | 195 | WP_065704055.1 | hypothetical protein | - |
| N7988_RS12705 (N7988_12705) | - | 2481559..2481846 (-) | 288 | WP_044585247.1 | DUF4183 domain-containing protein | - |
| N7988_RS12710 (N7988_12710) | - | 2482583..2483329 (-) | 747 | WP_060630991.1 | hypothetical protein | - |
| N7988_RS12715 (N7988_12715) | - | 2483491..2483670 (-) | 180 | WP_087967799.1 | hypothetical protein | - |
| N7988_RS12720 (N7988_12720) | - | 2484238..2484507 (+) | 270 | WP_065704051.1 | PadR family transcriptional regulator | - |
| N7988_RS12725 (N7988_12725) | - | 2484624..2484821 (+) | 198 | WP_065704049.1 | hypothetical protein | - |
| N7988_RS12730 (N7988_12730) | - | 2484938..2485108 (+) | 171 | WP_081306072.1 | hypothetical protein | - |
| N7988_RS12735 (N7988_12735) | - | 2485136..2485618 (+) | 483 | WP_016081851.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| N7988_RS12740 (N7988_12740) | - | 2485618..2486160 (+) | 543 | WP_001012135.1 | site-specific integrase | - |
| N7988_RS12745 (N7988_12745) | - | 2486375..2487325 (+) | 951 | WP_065704047.1 | nucleoside hydrolase | - |
| N7988_RS12750 (N7988_12750) | - | 2488137..2489306 (+) | 1170 | WP_016081850.1 | serine hydrolase domain-containing protein | - |
| N7988_RS12755 (N7988_12755) | - | 2489649..2489867 (+) | 219 | WP_000930969.1 | hypothetical protein | - |
| N7988_RS12760 (N7988_12760) | - | 2490239..2490514 (+) | 276 | WP_065704045.1 | hypothetical protein | - |
| N7988_RS12765 (N7988_12765) | - | 2490971..2491138 (+) | 168 | WP_179880280.1 | hypothetical protein | - |
| N7988_RS12770 (N7988_12770) | - | 2491131..2491304 (+) | 174 | WP_196776145.1 | hypothetical protein | - |
| N7988_RS12775 (N7988_12775) | - | 2491366..2491779 (+) | 414 | WP_065704040.1 | hypothetical protein | - |
| N7988_RS12780 (N7988_12780) | - | 2491760..2492101 (+) | 342 | WP_001258476.1 | HNH endonuclease | - |
| N7988_RS12785 (N7988_12785) | - | 2492252..2492608 (+) | 357 | WP_000763336.1 | hypothetical protein | - |
| N7988_RS12790 (N7988_12790) | - | 2492605..2494260 (+) | 1656 | WP_065704038.1 | terminase TerL endonuclease subunit | - |
| N7988_RS12795 (N7988_12795) | - | 2494326..2495432 (+) | 1107 | WP_065705031.1 | phage portal protein | - |
| N7988_RS12800 (N7988_12800) | - | 2495416..2496192 (+) | 777 | WP_065704036.1 | head maturation protease, ClpP-related | - |
| N7988_RS12805 (N7988_12805) | - | 2496212..2497375 (+) | 1164 | WP_065704034.1 | phage major capsid protein | - |
| N7988_RS12810 (N7988_12810) | - | 2497388..2497681 (+) | 294 | WP_065704032.1 | hypothetical protein | - |
| N7988_RS12815 (N7988_12815) | - | 2497683..2498036 (+) | 354 | WP_065704030.1 | phage head closure protein | - |
| N7988_RS12820 (N7988_12820) | - | 2498038..2498382 (+) | 345 | WP_065704028.1 | HK97 gp10 family phage protein | - |
| N7988_RS12825 (N7988_12825) | - | 2498379..2498717 (+) | 339 | WP_065704026.1 | hypothetical protein | - |
| N7988_RS12830 (N7988_12830) | - | 2498718..2499305 (+) | 588 | WP_065704024.1 | major tail protein | - |
| N7988_RS12835 (N7988_12835) | - | 2499312..2499674 (+) | 363 | WP_065704022.1 | hypothetical protein | - |
| N7988_RS12840 (N7988_12840) | - | 2499905..2503492 (+) | 3588 | WP_065704020.1 | DUF2207 domain-containing protein | - |
| N7988_RS12845 (N7988_12845) | - | 2503534..2504991 (+) | 1458 | WP_065704018.1 | distal tail protein Dit | - |
| N7988_RS12850 (N7988_12850) | - | 2504988..2509307 (+) | 4320 | WP_262314202.1 | phage tail spike protein | - |
| N7988_RS12855 (N7988_12855) | - | 2509319..2509693 (+) | 375 | WP_065704015.1 | hypothetical protein | - |
| N7988_RS12860 (N7988_12860) | - | 2509787..2510023 (+) | 237 | WP_025710285.1 | hemolysin XhlA family protein | - |
| N7988_RS12865 (N7988_12865) | - | 2510023..2510262 (+) | 240 | WP_000461725.1 | hypothetical protein | - |
| N7988_RS12870 (N7988_12870) | - | 2510259..2511323 (+) | 1065 | WP_025710284.1 | N-acetylmuramoyl-L-alanine amidase | - |
| N7988_RS12875 (N7988_12875) | - | 2511361..2512269 (+) | 909 | WP_065704013.1 | exosporium leader peptide-containing protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10097.74 Da Isoelectric Point: 5.1440
>NTDB_id=734032 N7988_RS12670 WP_065704062.1 2477302..2477580(+) (abrB) [Bacillus cereus strain SRCM116293]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALDFYVEGENIVLKKYENSCLVTGEVSETNIELLGGRMFLSKEGAIEL
LYLIQKSGMAHA
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALDFYVEGENIVLKKYENSCLVTGEVSETNIELLGGRMFLSKEGAIEL
LYLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=734032 N7988_RS12670 WP_065704062.1 2477302..2477580(+) (abrB) [Bacillus cereus strain SRCM116293]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACGTTAGG
GATTGCCGAAGGAACGGCACTAGATTTTTATGTCGAGGGTGAAAACATTGTTTTAAAAAAATATGAAAACTCATGCTTAG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGTATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACGTTAGG
GATTGCCGAAGGAACGGCACTAGATTTTTATGTCGAGGGTGAAAACATTGTTTTAAAAAAATATGAAAACTCATGCTTAG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGGGCAATTGAATTA
CTGTATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
63.218 |
94.565 |
0.598 |