Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   P5655_RS14355 Genome accession   NZ_CP120681
Coordinates   2620587..2620754 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis strain DSM 10     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 2615587..2625754
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5655_RS14325 (P5655_14325) mrpE 2615982..2616458 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  P5655_RS14330 (P5655_14330) mrpF 2616458..2616742 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  P5655_RS14335 (P5655_14335) mnhG 2616726..2617100 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  P5655_RS14340 (P5655_14340) yuxO 2617139..2617519 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  P5655_RS14345 (P5655_14345) comA 2617538..2618182 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  P5655_RS14350 (P5655_14350) comP 2618263..2620572 (-) 2310 WP_277723628.1 two-component system sensor histidine kinase ComP Regulator
  P5655_RS14355 (P5655_14355) comX 2620587..2620754 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  P5655_RS14360 (P5655_14360) comQ 2620742..2621641 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  P5655_RS14365 (P5655_14365) degQ 2621826..2621966 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P5655_RS14370 (P5655_14370) - 2622188..2622313 (+) 126 WP_003228793.1 hypothetical protein -
  P5655_RS14375 (P5655_14375) - 2622427..2622795 (+) 369 WP_003243784.1 hypothetical protein -
  P5655_RS14380 (P5655_14380) pdeH 2622771..2624000 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  P5655_RS14385 (P5655_14385) pncB 2624137..2625609 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=733896 P5655_RS14355 WP_003242801.1 2620587..2620754(-) (comX) [Bacillus subtilis strain DSM 10]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=733896 P5655_RS14355 WP_003242801.1 2620587..2620754(-) (comX) [Bacillus subtilis strain DSM 10]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1