Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   N7980_RS08860 Genome accession   NZ_CP106671
Coordinates   1692018..1692191 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM116301     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1687018..1697191
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N7980_RS08815 (N7980_08815) comGE 1687369..1687716 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  N7980_RS08820 (N7980_08820) comGF 1687742..1688125 (+) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  N7980_RS08825 (N7980_08825) comGG 1688126..1688500 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  N7980_RS08830 (N7980_08830) spoIITA 1688571..1688750 (+) 180 WP_003230176.1 YqzE family protein -
  N7980_RS08835 (N7980_08835) yqzG 1688792..1689118 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  N7980_RS08840 (N7980_08840) tapA 1689390..1690151 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  N7980_RS08845 (N7980_08845) sipW 1690135..1690707 (+) 573 WP_003246088.1 signal peptidase I SipW -
  N7980_RS08850 (N7980_08850) tasA 1690771..1691556 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  N7980_RS08855 (N7980_08855) sinR 1691649..1691984 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N7980_RS08860 (N7980_08860) sinI 1692018..1692191 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  N7980_RS08865 (N7980_08865) yqhG 1692374..1693168 (-) 795 WP_003230200.1 YqhG family protein -
  N7980_RS08870 (N7980_08870) hepAA 1693189..1694862 (-) 1674 WP_041850014.1 DEAD/DEAH box helicase -
  N7980_RS08875 (N7980_08875) gcvT 1695303..1696391 (+) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=733886 N7980_RS08860 WP_003230187.1 1692018..1692191(-) (sinI) [Bacillus subtilis strain SRCM116301]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=733886 N7980_RS08860 WP_003230187.1 1692018..1692191(-) (sinI) [Bacillus subtilis strain SRCM116301]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1