Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | P5647_RS12315 | Genome accession | NZ_CP120622 |
| Coordinates | 2408329..2408502 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain DSM 1090 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2403329..2413502
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5647_RS12300 (P5647_12300) | gcvT | 2404128..2405216 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| P5647_RS12305 (P5647_12305) | hepAA | 2405658..2407331 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| P5647_RS12310 (P5647_12310) | yqhG | 2407352..2408146 (+) | 795 | WP_277687258.1 | YqhG family protein | - |
| P5647_RS12315 (P5647_12315) | sinI | 2408329..2408502 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| P5647_RS12320 (P5647_12320) | sinR | 2408536..2408871 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| P5647_RS12325 (P5647_12325) | tasA | 2408964..2409749 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| P5647_RS12330 (P5647_12330) | sipW | 2409813..2410385 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| P5647_RS12335 (P5647_12335) | tapA | 2410369..2411130 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| P5647_RS12340 (P5647_12340) | yqzG | 2411402..2411728 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| P5647_RS12345 (P5647_12345) | spoIITA | 2411770..2411949 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| P5647_RS12350 (P5647_12350) | comGG | 2412020..2412394 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| P5647_RS12355 (P5647_12355) | comGF | 2412395..2412778 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| P5647_RS12360 (P5647_12360) | comGE | 2412804..2413151 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=733449 P5647_RS12315 WP_003230187.1 2408329..2408502(+) (sinI) [Bacillus subtilis strain DSM 1090]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=733449 P5647_RS12315 WP_003230187.1 2408329..2408502(+) (sinI) [Bacillus subtilis strain DSM 1090]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |