Detailed information    

insolico Bioinformatically predicted

Overview

Name   rapC   Type   Regulator
Locus tag   N8A75_RS22020 Genome accession   NZ_CP104878
Coordinates   725244..725471 (-) Length   75 a.a.
NCBI ID   WP_284691249.1    Uniprot ID   -
Organism   Bacillus subtilis strain 4ZT     
Function   inhibit the DNA-binding function of ComA (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 710178..727955 725244..725471 within 0


Gene organization within MGE regions


Location: 710178..727955
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N8A75_RS03655 (N8A75_03655) rlmD 710178..711560 (+) 1383 WP_129110459.1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD -
  N8A75_RS03660 (N8A75_03660) - 711977..712165 (+) 189 WP_035198876.1 helix-turn-helix domain-containing protein -
  N8A75_RS03665 (N8A75_03665) - 712186..712917 (+) 732 WP_082090360.1 DNA-methyltransferase -
  N8A75_RS03670 (N8A75_03670) - 712907..713995 (+) 1089 WP_046160152.1 DNA cytosine methyltransferase -
  N8A75_RS03675 (N8A75_03675) - 714000..716201 (+) 2202 WP_262091301.1 AAA family ATPase -
  N8A75_RS03680 (N8A75_03680) - 716198..717658 (+) 1461 WP_046160154.1 LlaJI family restriction endonuclease -
  N8A75_RS03685 (N8A75_03685) - 717676..718716 (+) 1041 WP_206734711.1 hypothetical protein -
  N8A75_RS03690 (N8A75_03690) - 718717..719544 (+) 828 WP_200897643.1 helix-turn-helix domain-containing protein -
  N8A75_RS03695 (N8A75_03695) - 720005..720838 (+) 834 WP_164907151.1 AbiJ-NTD4 domain-containing protein -
  N8A75_RS03700 (N8A75_03700) - 721134..722573 (+) 1440 WP_129110460.1 hypothetical protein -
  N8A75_RS03705 (N8A75_03705) - 722570..723670 (+) 1101 WP_129110461.1 hypothetical protein -
  N8A75_RS03710 (N8A75_03710) - 724150..724347 (-) 198 WP_129110462.1 hypothetical protein -
  N8A75_RS22010 - 724337..725041 (-) 705 WP_312026988.1 tetratricopeptide repeat protein -
  N8A75_RS22015 - 725017..725196 (-) 180 WP_315974251.1 hypothetical protein -
  N8A75_RS22020 rapC 725244..725471 (-) 228 WP_284691249.1 hypothetical protein Regulator
  N8A75_RS03720 (N8A75_03720) - 725652..725956 (-) 305 Protein_681 hypothetical protein -
  N8A75_RS03725 (N8A75_03725) yezA 726023..726229 (-) 207 WP_129110463.1 bacteriocin immunity protein -
  N8A75_RS03730 (N8A75_03730) - 726473..726943 (-) 471 WP_262091302.1 TIGR01741 family protein -
  N8A75_RS03735 (N8A75_03735) - 727022..727492 (-) 471 WP_129110464.1 immunity protein YezG family protein -
  N8A75_RS03740 (N8A75_03740) - 727482..727955 (-) 474 WP_129110465.1 antitoxin YezG family protein -

Sequence

Protein


Download         Length: 75 a.a.        Molecular weight: 8912.11 Da        Isoelectric Point: 4.2933

>NTDB_id=733161 N8A75_RS22020 WP_284691249.1 725244..725471(-) (rapC) [Bacillus subtilis strain 4ZT]
MRSLGTISSPHVGMEINEWNRHIQKFNVTDAEMLKTEIERDIDIMEEDQDLLLYYQLISFRHQLMIDYVIPSEGN

Nucleotide


Download         Length: 228 bp        

>NTDB_id=733161 N8A75_RS22020 WP_284691249.1 725244..725471(-) (rapC) [Bacillus subtilis strain 4ZT]
GTGAGGAGTTTAGGCACGATTTCGTCTCCGCACGTTGGAATGGAAATTAATGAGTGGAACCGGCATATTCAAAAGTTTAA
TGTGACTGACGCTGAAATGCTTAAAACTGAGATCGAACGGGACATTGACATCATGGAAGAAGACCAAGACCTCCTGCTTT
ACTATCAGCTCATTTCATTTCGCCATCAGCTTATGATCGACTATGTGATTCCATCTGAAGGAAACTAA

Domains

Predicted by InterproScan.

response regulator aspartate phosphatase H, N terminal (RapH_N)

(6-67)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rapC Bacillus subtilis subsp. subtilis str. 168

54.795

97.333

0.533
  rapF Bacillus subtilis subsp. subtilis str. 168

53.623

92

0.493