Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   P5661_RS16980 Genome accession   NZ_CP120600
Coordinates   3195434..3195574 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PRO112     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3190434..3200574
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5661_RS16955 (P5661_16955) yuxO 3190756..3191136 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  P5661_RS16960 (P5661_16960) comA 3191155..3191800 (-) 646 Protein_3271 two-component system response regulator ComA -
  P5661_RS16965 (P5661_16965) comP 3191881..3194199 (-) 2319 WP_161621287.1 sensor histidine kinase Regulator
  P5661_RS16970 (P5661_16970) comX 3194219..3194395 (-) 177 WP_041906074.1 competence pheromone ComX -
  P5661_RS16975 (P5661_16975) comQ 3194410..3195267 (-) 858 WP_309248341.1 polyprenyl synthetase family protein Regulator
  P5661_RS16980 (P5661_16980) degQ 3195434..3195574 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  P5661_RS16985 (P5661_16985) - 3195796..3195921 (+) 126 WP_161621781.1 hypothetical protein -
  P5661_RS16990 (P5661_16990) - 3196037..3196405 (+) 369 WP_017695529.1 hypothetical protein -
  P5661_RS16995 (P5661_16995) pdeH 3196381..3197610 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  P5661_RS17000 (P5661_17000) pncB 3197747..3199219 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  P5661_RS17005 (P5661_17005) pncA 3199235..3199786 (-) 552 WP_088326850.1 isochorismatase family cysteine hydrolase -
  P5661_RS17010 (P5661_17010) yueI 3199883..3200281 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=733025 P5661_RS16980 WP_003220708.1 3195434..3195574(-) (degQ) [Bacillus subtilis strain PRO112]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=733025 P5661_RS16980 WP_003220708.1 3195434..3195574(-) (degQ) [Bacillus subtilis strain PRO112]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1