Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   N6G78_RS15760 Genome accession   NZ_CP104855
Coordinates   3036726..3036866 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain TY-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3031726..3041866
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N6G78_RS15735 (N6G78_15735) yuxO 3032068..3032448 (-) 381 WP_015483631.1 hotdog fold thioesterase -
  N6G78_RS15740 (N6G78_15740) comA 3032466..3033111 (-) 646 Protein_3040 two-component system response regulator ComA -
  N6G78_RS15745 (N6G78_15745) comP 3033192..3035492 (-) 2301 WP_046340263.1 histidine kinase Regulator
  N6G78_RS15750 (N6G78_15750) comX 3035504..3035668 (-) 165 WP_015384519.1 competence pheromone ComX -
  N6G78_RS15755 (N6G78_15755) - 3035681..3036541 (-) 861 WP_015483633.1 polyprenyl synthetase family protein -
  N6G78_RS15760 (N6G78_15760) degQ 3036726..3036866 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  N6G78_RS15765 (N6G78_15765) - 3037088..3037150 (+) 63 Protein_3045 hypothetical protein -
  N6G78_RS15770 (N6G78_15770) - 3037328..3037696 (+) 369 WP_015483634.1 hypothetical protein -
  N6G78_RS15775 (N6G78_15775) pdeH 3037672..3038901 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  N6G78_RS15780 (N6G78_15780) pncB 3039038..3040510 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  N6G78_RS15785 (N6G78_15785) pncA 3040526..3041077 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  N6G78_RS15790 (N6G78_15790) yueI 3041174..3041572 (-) 399 WP_015483635.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=732726 N6G78_RS15760 WP_003220708.1 3036726..3036866(-) (degQ) [Bacillus subtilis strain TY-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=732726 N6G78_RS15760 WP_003220708.1 3036726..3036866(-) (degQ) [Bacillus subtilis strain TY-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1