Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   P3T66_RS06895 Genome accession   NZ_CP120512
Coordinates   1346433..1346732 (-) Length   99 a.a.
NCBI ID   WP_025016383.1    Uniprot ID   -
Organism   Latilactobacillus sakei strain PMC104     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1341433..1351732
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P3T66_RS06860 (P3T66_06860) - 1342064..1342522 (-) 459 WP_025016390.1 hypothetical protein -
  P3T66_RS06865 (P3T66_06865) - 1342577..1343773 (-) 1197 WP_251925651.1 acetate/propionate family kinase -
  P3T66_RS06870 (P3T66_06870) - 1343795..1344805 (-) 1011 WP_025016388.1 class I SAM-dependent methyltransferase -
  P3T66_RS06875 (P3T66_06875) - 1344929..1345267 (-) 339 WP_035145011.1 hypothetical protein -
  P3T66_RS06880 (P3T66_06880) comGF 1345230..1345742 (-) 513 WP_035145013.1 competence type IV pilus minor pilin ComGF Machinery gene
  P3T66_RS06885 (P3T66_06885) comGE 1345717..1346022 (-) 306 WP_016265375.1 hypothetical protein Machinery gene
  P3T66_RS06890 (P3T66_06890) comGD 1346009..1346461 (-) 453 WP_105300046.1 competence type IV pilus minor pilin ComGD Machinery gene
  P3T66_RS06895 (P3T66_06895) comGC 1346433..1346732 (-) 300 WP_025016383.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  P3T66_RS06900 (P3T66_06900) comGB 1346729..1347736 (-) 1008 WP_112234087.1 type II secretion system F family protein Machinery gene
  P3T66_RS06905 (P3T66_06905) comGA 1347729..1348619 (-) 891 WP_025016380.1 competence type IV pilus ATPase ComGA Machinery gene
  P3T66_RS06910 (P3T66_06910) - 1348736..1349467 (-) 732 WP_011375002.1 YebC/PmpR family DNA-binding transcriptional regulator -
  P3T66_RS06915 (P3T66_06915) - 1349558..1350058 (-) 501 WP_016265379.1 VanZ family protein -
  P3T66_RS06920 (P3T66_06920) - 1350155..1350529 (+) 375 WP_011375004.1 hypothetical protein -
  P3T66_RS06930 (P3T66_06930) - 1350716..1351330 (-) 615 WP_016265380.1 hypothetical protein -

Sequence


Protein


Download         Length: 99 a.a.        Molecular weight: 11067.03 Da        Isoelectric Point: 10.1321

>NTDB_id=732177 P3T66_RS06895 WP_025016383.1 1346433..1346732(-) (comGC) [Latilactobacillus sakei strain PMC104]
MKKKRNAFTLIEMVIVLAIVALLILLISPNLVAQKQRAEKKTDQALVTTLQTQVELAADEQGHQIKSLDELTDKYISKDQ
LKHAKEKGITIDSGTVKQK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=732177 P3T66_RS06895 WP_025016383.1 1346433..1346732(-) (comGC) [Latilactobacillus sakei strain PMC104]
ATGAAGAAAAAAAGAAATGCTTTTACATTAATCGAAATGGTAATTGTTCTAGCAATTGTGGCGTTGTTAATTTTATTAAT
CTCACCAAATTTGGTGGCTCAAAAACAGCGCGCGGAGAAGAAAACCGATCAAGCTTTAGTGACGACTTTACAAACGCAAG
TTGAATTGGCTGCCGATGAACAAGGTCATCAAATTAAGAGTCTAGATGAATTAACGGATAAGTATATTTCAAAAGACCAA
TTAAAGCACGCAAAGGAGAAGGGGATTACAATTGATAGCGGCACGGTTAAGCAAAAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Latilactobacillus sakei subsp. sakei 23K

89.899

100

0.899