Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   N6W67_RS04680 Genome accession   NZ_CP104698
Coordinates   929290..929424 (+) Length   44 a.a.
NCBI ID   WP_237584919.1    Uniprot ID   -
Organism   Proteus mirabilis strain NG-ABK-32     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Genomic Context

Location: 924290..934424
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N6W67_RS04620 (N6W67_04620) - 924567..924968 (-) 402 WP_261625392.1 Ig-like domain-containing protein -
  N6W67_RS04625 (N6W67_04625) - 925951..926049 (-) 99 Protein_895 hypothetical protein -
  N6W67_RS04630 (N6W67_04630) - 926052..926198 (-) 147 Protein_896 helix-turn-helix domain-containing protein -
  N6W67_RS04635 (N6W67_04635) - 926201..926416 (-) 216 Protein_897 helix-turn-helix domain-containing protein -
  N6W67_RS04640 (N6W67_04640) - 926446..926592 (+) 147 WP_261625393.1 helix-turn-helix domain-containing protein -
  N6W67_RS04645 (N6W67_04645) - 927181..927324 (-) 144 WP_004247166.1 Hok/Gef family protein -
  N6W67_RS04650 (N6W67_04650) - 927342..927536 (+) 195 Protein_900 hypothetical protein -
  N6W67_RS04655 (N6W67_04655) - 927711..928043 (-) 333 WP_261625394.1 hypothetical protein -
  N6W67_RS04660 (N6W67_04660) - 928250..928369 (-) 120 Protein_902 RNA-guided endonuclease TnpB family protein -
  N6W67_RS04665 (N6W67_04665) - 928456..928635 (+) 180 Protein_903 transposase -
  N6W67_RS04670 (N6W67_04670) - 928715..928837 (+) 123 WP_261625395.1 hypothetical protein -
  N6W67_RS04675 (N6W67_04675) - 928924..929061 (+) 138 Protein_905 RHS repeat-associated core domain-containing protein -
  N6W67_RS04680 (N6W67_04680) nucA/comI 929290..929424 (+) 135 WP_237584919.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  N6W67_RS04685 (N6W67_04685) - 929436..929945 (+) 510 WP_049212215.1 DUF6707 family protein -
  N6W67_RS04690 (N6W67_04690) - 930320..930829 (+) 510 WP_080047903.1 AHH domain-containing protein -
  N6W67_RS04695 (N6W67_04695) - 930826..931389 (+) 564 WP_049203038.1 hypothetical protein -
  N6W67_RS04700 (N6W67_04700) - 931445..931699 (+) 255 WP_261625396.1 hypothetical protein -
  N6W67_RS04705 (N6W67_04705) - 931680..931976 (+) 297 WP_261625397.1 Ig-like domain-containing protein -
  N6W67_RS04710 (N6W67_04710) - 932045..932200 (-) 156 Protein_912 helix-turn-helix domain-containing protein -
  N6W67_RS04715 (N6W67_04715) - 932222..932491 (+) 270 Protein_913 transposase -
  N6W67_RS04720 (N6W67_04720) ybjG 932912..933523 (+) 612 WP_004247606.1 undecaprenyl-diphosphate phosphatase -

Sequence

Protein


Download         Length: 44 a.a.        Molecular weight: 4624.25 Da        Isoelectric Point: 9.7833

>NTDB_id=731446 N6W67_RS04680 WP_237584919.1 929290..929424(+) (nucA/comI) [Proteus mirabilis strain NG-ABK-32]
MFKEGGKGASVRYISISDNRGAGSSISHALSPYPDGTKVKIIVE

Nucleotide


Download         Length: 135 bp        

>NTDB_id=731446 N6W67_RS04680 WP_237584919.1 929290..929424(+) (nucA/comI) [Proteus mirabilis strain NG-ABK-32]
ATGTTTAAAGAAGGGGGAAAAGGAGCGAGTGTAAGATATATTAGTATTAGTGATAATAGAGGTGCAGGTTCTTCTATATC
TCATGCATTATCCCCTTATCCTGATGGAACAAAAGTGAAAATTATTGTGGAATAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(2-42)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

63.636

100

0.636