Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   N5O74_RS08400 Genome accession   NZ_CP104509
Coordinates   1702126..1702755 (+) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain E2     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1689622..1726962 1702126..1702755 within 0


Gene organization within MGE regions


Location: 1689622..1726962
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N5O74_RS08350 (N5O74_08350) uup 1690952..1692859 (+) 1908 WP_000053099.1 ABC transporter ATP-binding protein -
  N5O74_RS08355 (N5O74_08355) pqiA 1692989..1694242 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  N5O74_RS08360 (N5O74_08360) pqiB 1694247..1695887 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  N5O74_RS08365 (N5O74_08365) pqiC 1695884..1696447 (+) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  N5O74_RS08370 (N5O74_08370) rmf 1696703..1696870 (+) 168 WP_000828648.1 ribosome modulation factor -
  N5O74_RS08375 (N5O74_08375) fabA 1696940..1697458 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  N5O74_RS08380 (N5O74_08380) ycbZ 1697527..1699287 (-) 1761 WP_000156518.1 Lon protease family protein -
  N5O74_RS08385 (N5O74_08385) matP 1699473..1699925 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  N5O74_RS08390 (N5O74_08390) ompA 1700001..1701041 (-) 1041 WP_000750416.1 porin OmpA -
  N5O74_RS08395 (N5O74_08395) sulA 1701398..1701907 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  N5O74_RS08400 (N5O74_08400) sxy/tfoX 1702126..1702755 (+) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  N5O74_RS08405 (N5O74_08405) yccS 1702718..1704880 (-) 2163 WP_000875061.1 YccS family putative transporter -
  N5O74_RS08410 (N5O74_08410) yccF 1704890..1705336 (-) 447 WP_001261235.1 YccF domain-containing protein -
  N5O74_RS08415 (N5O74_08415) helD 1705459..1707513 (+) 2055 WP_001295354.1 DNA helicase IV -
  N5O74_RS08420 (N5O74_08420) mgsA 1707545..1708003 (-) 459 WP_000424181.1 methylglyoxal synthase -
  N5O74_RS08425 (N5O74_08425) csgI 1708099..1708761 (-) 663 WP_000847791.1 DUF2057 family protein -
  N5O74_RS08430 (N5O74_08430) yccU 1708934..1709347 (+) 414 WP_001301418.1 CoA-binding protein -
  N5O74_RS08435 (N5O74_08435) hspQ 1709392..1709709 (-) 318 WP_001295356.1 heat shock protein HspQ -
  N5O74_RS08440 (N5O74_08440) rlmI 1709767..1710957 (-) 1191 WP_000116297.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  N5O74_RS08445 (N5O74_08445) yccX 1711052..1711330 (+) 279 WP_000048252.1 acylphosphatase -
  N5O74_RS08450 (N5O74_08450) tusE 1711327..1711656 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  N5O74_RS08455 (N5O74_08455) yccA 1711747..1712406 (-) 660 WP_000375136.1 FtsH protease modulator YccA -
  N5O74_RS08460 (N5O74_08460) - 1712814..1713833 (-) 1020 WP_077631503.1 tyrosine-type recombinase/integrase -
  N5O74_RS08465 (N5O74_08465) - 1713802..1714053 (-) 252 WP_000273165.1 DUF4224 domain-containing protein -
  N5O74_RS08470 (N5O74_08470) - 1714120..1716591 (-) 2472 WP_261205547.1 exonuclease -
  N5O74_RS08475 (N5O74_08475) - 1716684..1716875 (-) 192 WP_001090200.1 DUF1482 family protein -
  N5O74_RS08480 (N5O74_08480) dicB 1716872..1717060 (-) 189 WP_000449192.1 cell division inhibition protein DicB -
  N5O74_RS08485 (N5O74_08485) - 1717460..1717897 (+) 438 WP_261205548.1 hypothetical protein -
  N5O74_RS08490 (N5O74_08490) - 1717866..1718195 (-) 330 WP_029397859.1 hypothetical protein -
  N5O74_RS08495 (N5O74_08495) ydfC 1718218..1718436 (-) 219 WP_001171946.1 protein YdfC -
  N5O74_RS08500 (N5O74_08500) - 1718508..1718807 (-) 300 WP_089521815.1 hypothetical protein -
  N5O74_RS08505 (N5O74_08505) - 1719141..1719857 (-) 717 WP_000103683.1 LexA family protein -
  N5O74_RS08510 (N5O74_08510) - 1719907..1720119 (+) 213 WP_000471548.1 Cro/CI family transcriptional regulator -
  N5O74_RS08515 (N5O74_08515) - 1720119..1720544 (+) 426 WP_032176172.1 toxin YdaT family protein -
  N5O74_RS08520 (N5O74_08520) - 1720616..1721656 (+) 1041 WP_123009466.1 DnaT-like ssDNA-binding domain-containing protein -
  N5O74_RS08525 (N5O74_08525) - 1721649..1722110 (+) 462 WP_229975181.1 replication protein P -
  N5O74_RS08530 (N5O74_08530) - 1722143..1722913 (+) 771 WP_097504146.1 DUF1627 domain-containing protein -
  N5O74_RS08535 (N5O74_08535) - 1722929..1723353 (+) 425 Protein_1670 DUF977 family protein -
  N5O74_RS08540 (N5O74_08540) - 1723350..1723550 (+) 201 WP_001546006.1 hypothetical protein -
  N5O74_RS08545 (N5O74_08545) - 1723646..1723828 (+) 183 WP_001224945.1 hypothetical protein -
  N5O74_RS08550 (N5O74_08550) - 1723821..1723997 (+) 177 WP_000753060.1 hypothetical protein -
  N5O74_RS08555 (N5O74_08555) - 1723994..1724680 (+) 687 WP_261205551.1 ead/Ea22-like family protein -
  N5O74_RS27710 - 1724682..1725476 (+) 795 WP_314733619.1 DUF551 domain-containing protein -
  N5O74_RS08565 (N5O74_08565) - 1725476..1725871 (+) 396 WP_089616242.1 hypothetical protein -
  N5O74_RS08570 (N5O74_08570) hokD 1726140..1726295 (+) 156 WP_261205553.1 type I toxin-antitoxin system toxin HokD -
  N5O74_RS08575 (N5O74_08575) - 1726463..1726741 (+) 279 WP_053883582.1 hypothetical protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=730130 N5O74_RS08400 WP_000839153.1 1702126..1702755(+) (sxy/tfoX) [Escherichia coli strain E2]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=730130 N5O74_RS08400 WP_000839153.1 1702126..1702755(+) (sxy/tfoX) [Escherichia coli strain E2]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1