Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   N1207_RS17380 Genome accession   NZ_CP104097
Coordinates   3291685..3291825 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain GL-4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3286685..3296825
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N1207_RS17355 (N1207_17355) yuxO 3287028..3287408 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  N1207_RS17360 (N1207_17360) comA 3287427..3288071 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  N1207_RS17365 (N1207_17365) comP 3288152..3290452 (-) 2301 WP_088300729.1 histidine kinase Regulator
  N1207_RS17370 (N1207_17370) comX 3290464..3290628 (-) 165 WP_015384519.1 competence pheromone ComX -
  N1207_RS17375 (N1207_17375) - 3290641..3291501 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  N1207_RS17380 (N1207_17380) degQ 3291685..3291825 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  N1207_RS17385 (N1207_17385) - 3292047..3292109 (+) 63 Protein_3370 hypothetical protein -
  N1207_RS17390 (N1207_17390) - 3292288..3292656 (+) 369 WP_041850584.1 hypothetical protein -
  N1207_RS17395 (N1207_17395) pdeH 3292632..3293861 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  N1207_RS17400 (N1207_17400) pncB 3293998..3295470 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  N1207_RS17405 (N1207_17405) pncA 3295486..3296037 (-) 552 WP_043940186.1 cysteine hydrolase family protein -
  N1207_RS17410 (N1207_17410) yueI 3296134..3296532 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=727587 N1207_RS17380 WP_003220708.1 3291685..3291825(-) (degQ) [Bacillus subtilis strain GL-4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=727587 N1207_RS17380 WP_003220708.1 3291685..3291825(-) (degQ) [Bacillus subtilis strain GL-4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1