Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | N1207_RS14060 | Genome accession | NZ_CP104097 |
| Coordinates | 2679157..2679567 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis strain GL-4 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2672260..2726016 | 2679157..2679567 | within | 0 |
Gene organization within MGE regions
Location: 2672260..2726016
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N1207_RS14020 (N1207_14020) | yqeH | 2672260..2673360 (-) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| N1207_RS14025 (N1207_14025) | yqeG | 2673364..2673882 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| N1207_RS14030 (N1207_14030) | - | 2674244..2674384 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| N1207_RS14035 (N1207_14035) | yqeF | 2674689..2675420 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| N1207_RS14040 (N1207_14040) | cwlH | 2675672..2676424 (-) | 753 | WP_021480067.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| N1207_RS14045 (N1207_14045) | yqeD | 2676611..2677237 (+) | 627 | WP_041850032.1 | TVP38/TMEM64 family protein | - |
| N1207_RS14050 (N1207_14050) | gnd | 2677257..2678150 (-) | 894 | WP_041850033.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| N1207_RS14055 (N1207_14055) | yqeB | 2678402..2679124 (+) | 723 | WP_032726205.1 | hypothetical protein | - |
| N1207_RS14060 (N1207_14060) | nucA/comI | 2679157..2679567 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| N1207_RS14065 (N1207_14065) | - | 2679763..2680113 (+) | 351 | Protein_2732 | sigma-70 family RNA polymerase sigma factor | - |
| N1207_RS14070 (N1207_14070) | spoIVCA | 2680141..2681601 (-) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| N1207_RS14075 (N1207_14075) | - | 2681559..2681737 (-) | 179 | Protein_2734 | hypothetical protein | - |
| N1207_RS14080 (N1207_14080) | arsC | 2682092..2682511 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| N1207_RS14085 (N1207_14085) | acr3 | 2682523..2683563 (-) | 1041 | WP_032722149.1 | arsenite efflux transporter Acr3 | - |
| N1207_RS14090 (N1207_14090) | arsK | 2683586..2684026 (-) | 441 | WP_032722151.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| N1207_RS14095 (N1207_14095) | arsR | 2684085..2684402 (-) | 318 | WP_029318103.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| N1207_RS14100 (N1207_14100) | yqcI | 2684774..2685538 (-) | 765 | WP_017696291.1 | YqcI/YcgG family protein | - |
| N1207_RS14105 (N1207_14105) | rapE | 2685981..2687108 (+) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| N1207_RS14110 (N1207_14110) | phrE | 2687098..2687232 (+) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| N1207_RS14115 (N1207_14115) | - | 2687342..2687500 (+) | 159 | WP_003245945.1 | hypothetical protein | - |
| N1207_RS14120 (N1207_14120) | yqcG | 2687870..2689465 (+) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| N1207_RS14125 (N1207_14125) | yqcF | 2689480..2690058 (+) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| N1207_RS14130 (N1207_14130) | - | 2690176..2690322 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| N1207_RS14135 (N1207_14135) | - | 2690319..2690681 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| N1207_RS14140 (N1207_14140) | - | 2690697..2691176 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| N1207_RS14145 (N1207_14145) | cwlA | 2691341..2692159 (-) | 819 | WP_017697459.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| N1207_RS14150 (N1207_14150) | skhD | 2692204..2692626 (-) | 423 | WP_017697460.1 | holin family protein | - |
| N1207_RS14155 (N1207_14155) | xepAK | 2692672..2693565 (-) | 894 | WP_032722160.1 | hypothetical protein | - |
| N1207_RS14160 (N1207_14160) | yqcE | 2693653..2693817 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| N1207_RS14165 (N1207_14165) | yqcD | 2693814..2694149 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| N1207_RS14170 (N1207_14170) | yqcC | 2694159..2695259 (-) | 1101 | WP_032722161.1 | pyocin knob domain-containing protein | - |
| N1207_RS14175 (N1207_14175) | - | 2695263..2695535 (-) | 273 | WP_032722163.1 | hypothetical protein | - |
| N1207_RS14180 (N1207_14180) | yqcA | 2695532..2696110 (-) | 579 | WP_032722164.1 | YmfQ family protein | - |
| N1207_RS14185 (N1207_14185) | yqbT | 2696094..2697140 (-) | 1047 | WP_032722165.1 | baseplate J/gp47 family protein | - |
| N1207_RS14190 (N1207_14190) | yqbS | 2697133..2697558 (-) | 426 | WP_032722166.1 | DUF2634 domain-containing protein | - |
| N1207_RS14195 (N1207_14195) | yqbR | 2697571..2697837 (-) | 267 | WP_032722167.1 | DUF2577 family protein | - |
| N1207_RS14200 (N1207_14200) | yqbQ | 2697834..2698814 (-) | 981 | WP_032722168.1 | hypothetical protein | - |
| N1207_RS14205 (N1207_14205) | yqbP | 2698827..2699486 (-) | 660 | WP_032722169.1 | LysM peptidoglycan-binding domain-containing protein | - |
| N1207_RS14210 (N1207_14210) | yqbO | 2699479..2704236 (-) | 4758 | WP_043940167.1 | phage tail tape measure protein | - |
| N1207_RS14215 (N1207_14215) | - | 2704239..2704376 (-) | 138 | WP_021480099.1 | hypothetical protein | - |
| N1207_RS14220 (N1207_14220) | - | 2704418..2704867 (-) | 450 | WP_032722171.1 | phage tail assembly chaperone | - |
| N1207_RS14225 (N1207_14225) | txpA | 2705013..2705192 (+) | 180 | WP_128751232.1 | type I toxin-antitoxin system toxin TxpA | - |
| N1207_RS14230 (N1207_14230) | bsrH | 2705572..2705661 (+) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| N1207_RS14235 (N1207_14235) | yqbM | 2705915..2706358 (-) | 444 | WP_003229930.1 | phage tail tube protein | - |
| N1207_RS14240 (N1207_14240) | yqbK | 2706361..2707761 (-) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| N1207_RS14245 (N1207_14245) | - | 2707762..2707953 (-) | 192 | WP_010886574.1 | hypothetical protein | - |
| N1207_RS14250 (N1207_14250) | yqbJ | 2707950..2708387 (-) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| N1207_RS14255 (N1207_14255) | yqbI | 2708400..2708903 (-) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| N1207_RS14260 (N1207_14260) | yqbH | 2708900..2709262 (-) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| N1207_RS14265 (N1207_14265) | gkpG | 2709259..2709654 (-) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| N1207_RS14270 (N1207_14270) | yqbF | 2709658..2709969 (-) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| N1207_RS14275 (N1207_14275) | skdG | 2709980..2710915 (-) | 936 | WP_003229922.1 | phage major capsid protein | - |
| N1207_RS14280 (N1207_14280) | yqbD | 2710934..2711902 (-) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| N1207_RS14285 (N1207_14285) | - | 2711935..2712588 (-) | 654 | WP_003229920.1 | hypothetical protein | - |
| N1207_RS14290 (N1207_14290) | yqbB | 2712629..2713546 (-) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| N1207_RS14295 (N1207_14295) | yqbA | 2713543..2715075 (-) | 1533 | WP_004398894.1 | phage portal protein | - |
| N1207_RS14300 (N1207_14300) | stmB | 2715079..2716374 (-) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| N1207_RS14305 (N1207_14305) | terS | 2716367..2717086 (-) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| N1207_RS14310 (N1207_14310) | - | 2717154..2717618 (-) | 465 | WP_004398685.1 | hypothetical protein | - |
| N1207_RS14315 (N1207_14315) | yqaQ | 2717762..2718217 (-) | 456 | WP_004398775.1 | hypothetical protein | - |
| N1207_RS14320 (N1207_14320) | - | 2718415..2719344 (+) | 930 | WP_003229913.1 | hypothetical protein | - |
| N1207_RS14325 (N1207_14325) | yqaO | 2719418..2719624 (-) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| N1207_RS14330 (N1207_14330) | yqaN | 2719706..2720134 (-) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N1207_RS14335 (N1207_14335) | - | 2720230..2720379 (-) | 150 | WP_003229910.1 | hypothetical protein | - |
| N1207_RS14340 (N1207_14340) | sknM | 2720370..2721311 (-) | 942 | WP_075058863.1 | ATP-binding protein | - |
| N1207_RS14345 (N1207_14345) | yqaL | 2721193..2721870 (-) | 678 | WP_116362964.1 | DnaD domain-containing protein | - |
| N1207_RS14350 (N1207_14350) | recT | 2721946..2722800 (-) | 855 | WP_003229907.1 | recombinase RecT | - |
| N1207_RS14355 (N1207_14355) | yqaJ | 2722803..2723762 (-) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| N1207_RS14360 (N1207_14360) | - | 2723868..2724062 (-) | 195 | WP_003229905.1 | YqaI family protein | - |
| N1207_RS14365 (N1207_14365) | - | 2724022..2724195 (-) | 174 | WP_119123069.1 | hypothetical protein | - |
| N1207_RS14370 (N1207_14370) | sknH | 2724192..2724449 (-) | 258 | WP_003245994.1 | YqaH family protein | - |
| N1207_RS14375 (N1207_14375) | yqaG | 2724446..2725015 (-) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| N1207_RS14380 (N1207_14380) | - | 2725089..2725229 (-) | 141 | WP_003229902.1 | hypothetical protein | - |
| N1207_RS14385 (N1207_14385) | yqaF | 2725259..2725489 (-) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| N1207_RS14390 (N1207_14390) | sknR | 2725666..2726016 (+) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=727576 N1207_RS14060 WP_009967785.1 2679157..2679567(-) (nucA/comI) [Bacillus subtilis strain GL-4]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=727576 N1207_RS14060 WP_009967785.1 2679157..2679567(-) (nucA/comI) [Bacillus subtilis strain GL-4]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCAATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCAATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |