Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   P1K87_RS11725 Genome accession   NZ_CP119596
Coordinates   2447955..2448128 (+) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain MG-2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2442955..2453128
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P1K87_RS11710 (P1K87_11710) gcvT 2443769..2444869 (-) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -
  P1K87_RS11715 (P1K87_11715) - 2445292..2446962 (+) 1671 WP_032874031.1 SNF2-related protein -
  P1K87_RS11720 (P1K87_11720) - 2446984..2447778 (+) 795 WP_007612541.1 YqhG family protein -
  P1K87_RS11725 (P1K87_11725) sinI 2447955..2448128 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  P1K87_RS11730 (P1K87_11730) sinR 2448162..2448497 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  P1K87_RS11735 (P1K87_11735) - 2448545..2449330 (-) 786 WP_032874027.1 TasA family protein -
  P1K87_RS11740 (P1K87_11740) - 2449395..2449979 (-) 585 WP_032874025.1 signal peptidase I -
  P1K87_RS11745 (P1K87_11745) tapA 2449951..2450622 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  P1K87_RS11750 (P1K87_11750) - 2450881..2451210 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  P1K87_RS11755 (P1K87_11755) - 2451251..2451430 (-) 180 WP_022552966.1 YqzE family protein -
  P1K87_RS11760 (P1K87_11760) comGG 2451487..2451864 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  P1K87_RS11765 (P1K87_11765) comGF 2451865..2452365 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  P1K87_RS11770 (P1K87_11770) comGE 2452274..2452588 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  P1K87_RS11775 (P1K87_11775) comGD 2452572..2453009 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=726882 P1K87_RS11725 WP_032874029.1 2447955..2448128(+) (sinI) [Bacillus amyloliquefaciens strain MG-2]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=726882 P1K87_RS11725 WP_032874029.1 2447955..2448128(+) (sinI) [Bacillus amyloliquefaciens strain MG-2]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719