Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NX081_RS16170 Genome accession   NZ_CP103856
Coordinates   3227770..3227910 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM116265     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3222770..3232910
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX081_RS16145 (NX081_16145) - 3223084..3223467 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  NX081_RS16150 (NX081_16150) comA 3223489..3224133 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  NX081_RS16155 (NX081_16155) comP 3224214..3226565 (-) 2352 WP_269461318.1 sensor histidine kinase Regulator
  NX081_RS16160 (NX081_16160) comX 3226543..3226713 (-) 171 WP_015418105.1 competence pheromone ComX -
  NX081_RS16165 (NX081_16165) - 3226710..3227639 (-) 930 WP_231945405.1 polyprenyl synthetase family protein -
  NX081_RS16170 (NX081_16170) degQ 3227770..3227910 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NX081_RS16175 (NX081_16175) - 3228375..3228716 (+) 342 WP_060561880.1 hypothetical protein -
  NX081_RS16180 (NX081_16180) - 3228723..3229946 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  NX081_RS16185 (NX081_16185) - 3230076..3231542 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  NX081_RS16190 (NX081_16190) - 3231560..3232111 (-) 552 WP_060561881.1 cysteine hydrolase family protein -
  NX081_RS16195 (NX081_16195) - 3232208..3232606 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=726111 NX081_RS16170 WP_003152043.1 3227770..3227910(-) (degQ) [Bacillus velezensis strain SRCM116265]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=726111 NX081_RS16170 WP_003152043.1 3227770..3227910(-) (degQ) [Bacillus velezensis strain SRCM116265]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891