Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NX081_RS13125 Genome accession   NZ_CP103856
Coordinates   2658224..2658397 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SRCM116265     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2653224..2663397
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX081_RS13110 (NX081_13110) gcvT 2654041..2655141 (-) 1101 WP_015388009.1 glycine cleavage system aminomethyltransferase GcvT -
  NX081_RS13115 (NX081_13115) - 2655565..2657235 (+) 1671 WP_060562612.1 DEAD/DEAH box helicase -
  NX081_RS13120 (NX081_13120) - 2657253..2658047 (+) 795 WP_060562613.1 YqhG family protein -
  NX081_RS13125 (NX081_13125) sinI 2658224..2658397 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NX081_RS13130 (NX081_13130) sinR 2658431..2658766 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NX081_RS13135 (NX081_13135) tasA 2658814..2659599 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NX081_RS13140 (NX081_13140) sipW 2659663..2660247 (-) 585 WP_060562614.1 signal peptidase I SipW -
  NX081_RS13145 (NX081_13145) tapA 2660219..2660890 (-) 672 WP_060562615.1 amyloid fiber anchoring/assembly protein TapA -
  NX081_RS13150 (NX081_13150) - 2661149..2661478 (+) 330 WP_060562616.1 DUF3889 domain-containing protein -
  NX081_RS13155 (NX081_13155) - 2661518..2661697 (-) 180 WP_003153093.1 YqzE family protein -
  NX081_RS13160 (NX081_13160) comGG 2661754..2662131 (-) 378 WP_060562617.1 competence type IV pilus minor pilin ComGG Machinery gene
  NX081_RS13165 (NX081_13165) comGF 2662132..2662632 (-) 501 WP_014305411.1 competence type IV pilus minor pilin ComGF -
  NX081_RS13170 (NX081_13170) comGE 2662541..2662855 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  NX081_RS13175 (NX081_13175) comGD 2662839..2663276 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=726089 NX081_RS13125 WP_003153105.1 2658224..2658397(+) (sinI) [Bacillus velezensis strain SRCM116265]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=726089 NX081_RS13125 WP_003153105.1 2658224..2658397(+) (sinI) [Bacillus velezensis strain SRCM116265]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702