Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   NX081_RS02005 Genome accession   NZ_CP103856
Coordinates   399313..399432 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SRCM116265     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 394313..404432
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX081_RS01990 (NX081_01990) - 395925..396608 (+) 684 WP_060563078.1 response regulator transcription factor -
  NX081_RS01995 (NX081_01995) - 396595..398028 (+) 1434 WP_162262652.1 HAMP domain-containing sensor histidine kinase -
  NX081_RS02000 (NX081_02000) rapC 398181..399329 (+) 1149 WP_003156336.1 Rap family tetratricopeptide repeat protein Regulator
  NX081_RS02005 (NX081_02005) phrC 399313..399432 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  NX081_RS02010 (NX081_02010) - 399583..399693 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  NX081_RS02015 (NX081_02015) - 399773..401137 (-) 1365 WP_060563080.1 aspartate kinase -
  NX081_RS02020 (NX081_02020) ceuB 401553..402506 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  NX081_RS02025 (NX081_02025) - 402496..403443 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  NX081_RS02030 (NX081_02030) - 403437..404195 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=726059 NX081_RS02005 WP_003156334.1 399313..399432(+) (phrC) [Bacillus velezensis strain SRCM116265]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=726059 NX081_RS02005 WP_003156334.1 399313..399432(+) (phrC) [Bacillus velezensis strain SRCM116265]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718