Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | NYR92_RS13940 | Genome accession | NZ_CP103783 |
| Coordinates | 2651737..2652147 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis subsp. subtilis str. 168 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2644840..2698593 | 2651737..2652147 | within | 0 |
Gene organization within MGE regions
Location: 2644840..2698593
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYR92_RS13900 (NYR92_13900) | yqeH | 2644840..2645940 (-) | 1101 | WP_003229966.1 | ribosome biogenesis GTPase YqeH | - |
| NYR92_RS13905 (NYR92_13905) | yqeG | 2645944..2646462 (-) | 519 | WP_003226126.1 | YqeG family HAD IIIA-type phosphatase | - |
| NYR92_RS13910 (NYR92_13910) | - | 2646824..2646964 (+) | 141 | WP_003226124.1 | sporulation histidine kinase inhibitor Sda | - |
| NYR92_RS13915 (NYR92_13915) | yqeF | 2647270..2648001 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| NYR92_RS13920 (NYR92_13920) | cwlH | 2648253..2649005 (-) | 753 | WP_003229963.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| NYR92_RS13925 (NYR92_13925) | yqeD | 2649192..2649818 (+) | 627 | WP_003229962.1 | TVP38/TMEM64 family protein | - |
| NYR92_RS13930 (NYR92_13930) | gnd | 2649837..2650730 (-) | 894 | WP_003229961.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| NYR92_RS13935 (NYR92_13935) | yqeB | 2650982..2651704 (+) | 723 | WP_010886572.1 | hypothetical protein | - |
| NYR92_RS13940 (NYR92_13940) | nucA/comI | 2651737..2652147 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| NYR92_RS13945 (NYR92_13945) | - | 2652343..2652693 (+) | 351 | Protein_2702 | sigma-70 family RNA polymerase sigma factor | - |
| NYR92_RS13950 (NYR92_13950) | spoIVCA | 2652721..2654181 (-) | 1461 | WP_223257626.1 | site-specific DNA recombinase SpoIVCA | - |
| NYR92_RS13955 (NYR92_13955) | - | 2654139..2654317 (-) | 179 | Protein_2704 | hypothetical protein | - |
| NYR92_RS13960 (NYR92_13960) | arsC | 2654672..2655091 (-) | 420 | WP_004398596.1 | thioredoxin-dependent arsenate reductase | - |
| NYR92_RS13965 (NYR92_13965) | acr3 | 2655103..2656143 (-) | 1041 | WP_004398718.1 | arsenite efflux transporter Acr3 | - |
| NYR92_RS13970 (NYR92_13970) | arsK | 2656166..2656606 (-) | 441 | WP_003229954.1 | ArsI/CadI family heavy metal resistance metalloenzyme | - |
| NYR92_RS13975 (NYR92_13975) | arsR | 2656667..2656984 (-) | 318 | WP_004399122.1 | arsenical resistance operon transcriptional regulator ArsR | - |
| NYR92_RS13980 (NYR92_13980) | yqcI | 2657356..2658120 (-) | 765 | WP_004398670.1 | YqcI/YcgG family protein | - |
| NYR92_RS13985 (NYR92_13985) | rapE | 2658563..2659690 (+) | 1128 | WP_004398842.1 | response regulator aspartate phosphatase RapE | - |
| NYR92_RS13990 (NYR92_13990) | phrE | 2659680..2659814 (+) | 135 | WP_004398770.1 | phosphatase RapE inhibitor PhrE | - |
| NYR92_RS13995 (NYR92_13995) | - | 2659924..2660082 (+) | 159 | WP_003245945.1 | hypothetical protein | - |
| NYR92_RS14000 (NYR92_14000) | yqcG | 2660452..2662047 (+) | 1596 | WP_004399034.1 | LXG family T7SS effector endonuclease toxin YqcG | - |
| NYR92_RS14005 (NYR92_14005) | yqcF | 2662062..2662640 (+) | 579 | WP_009967790.1 | type VII secretion system immunity protein YqcF | - |
| NYR92_RS14010 (NYR92_14010) | - | 2662758..2662904 (+) | 147 | WP_009967791.1 | hypothetical protein | - |
| NYR92_RS14015 (NYR92_14015) | - | 2662901..2663263 (-) | 363 | WP_003229947.1 | hypothetical protein | - |
| NYR92_RS14020 (NYR92_14020) | - | 2663279..2663758 (-) | 480 | WP_004399085.1 | hypothetical protein | - |
| NYR92_RS14025 (NYR92_14025) | cwlA | 2663923..2664741 (-) | 819 | WP_003229946.1 | N-acetylmuramoyl-L-alanine amidase CwlA | - |
| NYR92_RS14030 (NYR92_14030) | skhD | 2664786..2665208 (-) | 423 | WP_003246208.1 | holin family protein | - |
| NYR92_RS14035 (NYR92_14035) | xepAK | 2665253..2666146 (-) | 894 | WP_003246010.1 | hypothetical protein | - |
| NYR92_RS14040 (NYR92_14040) | yqcE | 2666234..2666398 (-) | 165 | WP_003229944.1 | XkdX family protein | - |
| NYR92_RS14045 (NYR92_14045) | yqcD | 2666395..2666730 (-) | 336 | WP_009967793.1 | XkdW family protein | - |
| NYR92_RS14050 (NYR92_14050) | yqcC | 2666740..2667840 (-) | 1101 | WP_003229943.1 | pyocin knob domain-containing protein | - |
| NYR92_RS14055 (NYR92_14055) | - | 2667843..2668115 (-) | 273 | WP_003229942.1 | hypothetical protein | - |
| NYR92_RS14060 (NYR92_14060) | yqcA | 2668112..2668690 (-) | 579 | WP_003229941.1 | YmfQ family protein | - |
| NYR92_RS14065 (NYR92_14065) | yqbT | 2668674..2669720 (-) | 1047 | WP_003229940.1 | baseplate J/gp47 family protein | - |
| NYR92_RS14070 (NYR92_14070) | yqbS | 2669713..2670138 (-) | 426 | WP_004398572.1 | DUF2634 domain-containing protein | - |
| NYR92_RS14075 (NYR92_14075) | yqbR | 2670151..2670414 (-) | 264 | WP_003229938.1 | DUF2577 family protein | - |
| NYR92_RS14080 (NYR92_14080) | yqbQ | 2670411..2671391 (-) | 981 | WP_004398524.1 | hypothetical protein | - |
| NYR92_RS14085 (NYR92_14085) | yqbP | 2671404..2672063 (-) | 660 | WP_004398548.1 | LysM peptidoglycan-binding domain-containing protein | - |
| NYR92_RS14090 (NYR92_14090) | yqbO | 2672056..2676813 (-) | 4758 | WP_003246092.1 | phage tail tape measure protein | - |
| NYR92_RS14095 (NYR92_14095) | - | 2676816..2676953 (-) | 138 | WP_003229934.1 | hypothetical protein | - |
| NYR92_RS14100 (NYR92_14100) | - | 2676995..2677444 (-) | 450 | WP_003229933.1 | phage tail assembly chaperone | - |
| NYR92_RS14105 (NYR92_14105) | txpA | 2677590..2677769 (+) | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | - |
| NYR92_RS14110 (NYR92_14110) | bsrH | 2678149..2678238 (+) | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| NYR92_RS14115 (NYR92_14115) | yqbM | 2678492..2678935 (-) | 444 | WP_003229930.1 | phage tail tube protein | - |
| NYR92_RS14120 (NYR92_14120) | yqbK | 2678938..2680338 (-) | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
| NYR92_RS14125 (NYR92_14125) | - | 2680339..2680530 (-) | 192 | WP_010886574.1 | hypothetical protein | - |
| NYR92_RS14130 (NYR92_14130) | yqbJ | 2680527..2680964 (-) | 438 | WP_003229927.1 | DUF6838 family protein | - |
| NYR92_RS14135 (NYR92_14135) | yqbI | 2680977..2681480 (-) | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| NYR92_RS14140 (NYR92_14140) | yqbH | 2681477..2681839 (-) | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| NYR92_RS14145 (NYR92_14145) | gkpG | 2681836..2682231 (-) | 396 | WP_004398566.1 | DUF3199 family protein | - |
| NYR92_RS14150 (NYR92_14150) | yqbF | 2682235..2682546 (-) | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
| NYR92_RS14155 (NYR92_14155) | skdG | 2682557..2683492 (-) | 936 | WP_003229922.1 | phage major capsid protein | - |
| NYR92_RS14160 (NYR92_14160) | yqbD | 2683511..2684479 (-) | 969 | WP_003229921.1 | XkdF-like putative serine protease domain-containing protein | - |
| NYR92_RS14165 (NYR92_14165) | - | 2684512..2685165 (-) | 654 | WP_003229920.1 | hypothetical protein | - |
| NYR92_RS14170 (NYR92_14170) | yqbB | 2685206..2686123 (-) | 918 | WP_004398748.1 | phage head morphogenesis protein | - |
| NYR92_RS14175 (NYR92_14175) | yqbA | 2686120..2687652 (-) | 1533 | WP_004398894.1 | phage portal protein | - |
| NYR92_RS14180 (NYR92_14180) | stmB | 2687656..2688951 (-) | 1296 | WP_003229917.1 | PBSX family phage terminase large subunit | - |
| NYR92_RS14185 (NYR92_14185) | terS | 2688944..2689663 (-) | 720 | WP_003229916.1 | phage terminase small subunit | - |
| NYR92_RS14190 (NYR92_14190) | - | 2689731..2690195 (-) | 465 | WP_004398685.1 | hypothetical protein | - |
| NYR92_RS14195 (NYR92_14195) | yqaQ | 2690339..2690794 (-) | 456 | WP_004398775.1 | hypothetical protein | - |
| NYR92_RS14200 (NYR92_14200) | - | 2690992..2691921 (+) | 930 | WP_003229913.1 | hypothetical protein | - |
| NYR92_RS14205 (NYR92_14205) | yqaO | 2691995..2692201 (-) | 207 | WP_003229912.1 | XtrA/YqaO family protein | - |
| NYR92_RS14210 (NYR92_14210) | yqaN | 2692283..2692711 (-) | 429 | WP_009967809.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NYR92_RS14215 (NYR92_14215) | - | 2692807..2692956 (-) | 150 | WP_003229910.1 | hypothetical protein | - |
| NYR92_RS14220 (NYR92_14220) | sknM | 2692947..2693888 (-) | 942 | WP_075058863.1 | ATP-binding protein | - |
| NYR92_RS14225 (NYR92_14225) | yqaL | 2693770..2694447 (-) | 678 | WP_010886575.1 | DnaD domain-containing protein | - |
| NYR92_RS14230 (NYR92_14230) | recT | 2694523..2695377 (-) | 855 | WP_003229907.1 | recombinase RecT | - |
| NYR92_RS14235 (NYR92_14235) | yqaJ | 2695380..2696339 (-) | 960 | WP_004398673.1 | YqaJ viral recombinase family protein | - |
| NYR92_RS14240 (NYR92_14240) | - | 2696445..2696639 (-) | 195 | WP_003229905.1 | YqaI family protein | - |
| NYR92_RS14245 (NYR92_14245) | - | 2696599..2696772 (-) | 174 | WP_119123069.1 | hypothetical protein | - |
| NYR92_RS14250 (NYR92_14250) | sknH | 2696769..2697026 (-) | 258 | WP_003245994.1 | YqaH family protein | - |
| NYR92_RS14255 (NYR92_14255) | yqaG | 2697023..2697592 (-) | 570 | WP_004398626.1 | helix-turn-helix transcriptional regulator | - |
| NYR92_RS14260 (NYR92_14260) | - | 2697666..2697806 (-) | 141 | WP_003229902.1 | hypothetical protein | - |
| NYR92_RS14265 (NYR92_14265) | yqaF | 2697836..2698066 (-) | 231 | WP_004398958.1 | helix-turn-helix transcriptional regulator | - |
| NYR92_RS14270 (NYR92_14270) | sknR | 2698243..2698593 (+) | 351 | WP_004398704.1 | transcriptional regulator SknR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=724949 NYR92_RS13940 WP_009967785.1 2651737..2652147(-) (nucA/comI) [Bacillus subtilis subsp. subtilis str. 168]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=724949 NYR92_RS13940 WP_009967785.1 2651737..2652147(-) (nucA/comI) [Bacillus subtilis subsp. subtilis str. 168]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGTGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |