Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   NYR48_RS01980 Genome accession   NZ_CP103782
Coordinates   390366..390485 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain DA4     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 385366..395485
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR48_RS01965 - 386978..387661 (+) 684 WP_007410267.1 response regulator transcription factor -
  NYR48_RS01970 - 387648..389081 (+) 1434 WP_259424968.1 HAMP domain-containing sensor histidine kinase -
  NYR48_RS01975 rapC 389234..390382 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  NYR48_RS01980 phrC 390366..390485 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  NYR48_RS01985 - 390633..390734 (-) 102 WP_239033885.1 YjcZ family sporulation protein -
  NYR48_RS01990 - 390829..392193 (-) 1365 WP_259424969.1 aspartate kinase -
  NYR48_RS01995 ceuB 392607..393560 (+) 954 WP_032872883.1 ABC transporter permease Machinery gene
  NYR48_RS02000 - 393550..394497 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  NYR48_RS02005 - 394491..395249 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=724825 NYR48_RS01980 WP_003156334.1 390366..390485(+) (phrC) [Bacillus velezensis strain DA4]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=724825 NYR48_RS01980 WP_003156334.1 390366..390485(+) (phrC) [Bacillus velezensis strain DA4]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718