Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NYR93_RS00570 Genome accession   NZ_CP103769
Coordinates   111782..111922 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain ML61     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 106782..116922
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR93_RS00545 (NYR93_00545) - 107088..107486 (+) 399 WP_003152031.1 YueI family protein -
  NYR93_RS00550 (NYR93_00550) - 107583..108134 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  NYR93_RS00555 (NYR93_00555) - 108152..109618 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  NYR93_RS00560 (NYR93_00560) - 109748..110968 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  NYR93_RS00565 (NYR93_00565) - 110975..111316 (-) 342 WP_014305721.1 hypothetical protein -
  NYR93_RS00570 (NYR93_00570) degQ 111782..111922 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NYR93_RS00575 (NYR93_00575) - 112074..112985 (+) 912 WP_014305720.1 polyprenyl synthetase family protein -
  NYR93_RS00580 (NYR93_00580) comX 112985..113149 (+) 165 WP_007613432.1 competence pheromone ComX -
  NYR93_RS00585 (NYR93_00585) comP 113161..115452 (+) 2292 WP_014305719.1 histidine kinase Regulator
  NYR93_RS00590 (NYR93_00590) comA 115533..116177 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  NYR93_RS00595 (NYR93_00595) - 116199..116582 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=724593 NYR93_RS00570 WP_003152043.1 111782..111922(+) (degQ) [Bacillus velezensis strain ML61]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=724593 NYR93_RS00570 WP_003152043.1 111782..111922(+) (degQ) [Bacillus velezensis strain ML61]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891