Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB/nlmE   Type   Regulator
Locus tag   PYW37_RS00505 Genome accession   NZ_CP118969
Coordinates   86556..86768 (+) Length   70 a.a.
NCBI ID   WP_228764334.1    Uniprot ID   -
Organism   Lactococcus lactis strain DSM 20481     
Function   transport of ComC (predicted from homology)   
Competence regulation

Genomic Context

Location: 81556..91768
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PYW37_RS00470 - 81942..82442 (+) 501 WP_223848591.1 HlyD family efflux transporter periplasmic adaptor subunit -
  PYW37_RS00475 - 82537..82662 (+) 126 WP_021214955.1 lactococcin family bacteriocin -
  PYW37_RS00480 - 82988..83356 (+) 369 WP_223848592.1 transporter -
  PYW37_RS00485 - 83395..84051 (+) 657 WP_021214956.1 type II CAAX endopeptidase family protein -
  PYW37_RS00490 - 84154..84435 (-) 282 WP_010905098.1 hypothetical protein -
  PYW37_RS00495 - 84445..84597 (-) 153 WP_010905099.1 hypothetical protein -
  PYW37_RS00500 - 84963..86282 (-) 1320 WP_011834695.1 IS4-like element IS1675 family transposase -
  PYW37_RS00505 comB/nlmE 86556..86768 (+) 213 WP_228764334.1 hypothetical protein Regulator
  PYW37_RS00510 - 86862..86999 (+) 138 WP_021214958.1 lactococcin family bacteriocin -
  PYW37_RS00515 - 87044..87724 (+) 681 WP_225509962.1 CPBP family intramembrane glutamic endopeptidase -
  PYW37_RS00520 - 88150..88602 (+) 453 WP_023189490.1 hypothetical protein -
  PYW37_RS00525 - 88813..89475 (-) 663 WP_023189491.1 CPBP family intramembrane glutamic endopeptidase -
  PYW37_RS00530 - 89784..89963 (-) 180 WP_023163573.1 hypothetical protein -
  PYW37_RS00535 - 89984..90163 (-) 180 WP_023163574.1 lactococcin family bacteriocin -
  PYW37_RS00540 - 90437..90535 (+) 99 WP_223848594.1 lactococcin family bacteriocin -
  PYW37_RS00545 - 90597..90871 (+) 275 Protein_98 hypothetical protein -
  PYW37_RS00550 - 91066..91248 (+) 183 WP_023163576.1 hypothetical protein -
  PYW37_RS00555 - 91250..91504 (+) 255 WP_023189493.1 hypothetical protein -

Sequence

Protein


Download         Length: 70 a.a.        Molecular weight: 7990.44 Da        Isoelectric Point: 10.4073

>NTDB_id=724182 PYW37_RS00505 WP_228764334.1 86556..86768(+) (comB/nlmE) [Lactococcus lactis strain DSM 20481]
MTGIFLLFLIFKSFPTIFKEENAYKVSATTAINAKDLPNIRYGLQGKTVTIIGKKTYFNYFLDKIMGRTS

Nucleotide


Download         Length: 213 bp        

>NTDB_id=724182 PYW37_RS00505 WP_228764334.1 86556..86768(+) (comB/nlmE) [Lactococcus lactis strain DSM 20481]
TTGACGGGTATATTTCTTTTATTTTTAATTTTTAAATCTTTTCCTACTATCTTTAAAGAGGAAAATGCTTATAAAGTTTC
TGCGACAACCGCTATCAATGCAAAAGACCTCCCAAATATAAGGTATGGCTTGCAAGGAAAAACGGTGACCATTATTGGAA
AGAAAACTTATTTCAATTACTTTTTAGATAAAATTATGGGGAGGACTTCATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB/nlmE Streptococcus mutans UA159

46.429

80

0.371