Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   NX050_RS08705 Genome accession   NZ_CP103456
Coordinates   1651420..1651830 (+) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain PN176 (HK176)     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1627505..1666673 1651420..1651830 within 0


Gene organization within MGE regions


Location: 1627505..1666673
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX050_RS08530 (NX050_08530) bltR 1627505..1628326 (+) 822 WP_014480349.1 multidrug efflux transcriptional regulator BltR -
  NX050_RS08535 (NX050_08535) - 1628534..1628714 (+) 181 Protein_1674 hypothetical protein -
  NX050_RS08540 (NX050_08540) - 1629023..1629253 (+) 231 WP_224588644.1 hypothetical protein -
  NX050_RS08545 (NX050_08545) - 1629398..1629646 (+) 249 Protein_1676 hypothetical protein -
  NX050_RS08550 (NX050_08550) - 1629609..1629731 (+) 123 Protein_1677 RusA family crossover junction endodeoxyribonuclease -
  NX050_RS08555 (NX050_08555) - 1629814..1629966 (+) 153 WP_049832653.1 XtrA/YqaO family protein -
  NX050_RS08560 (NX050_08560) - 1630105..1630371 (-) 267 WP_033881358.1 hypothetical protein -
  NX050_RS08565 (NX050_08565) - 1630988..1631467 (+) 480 WP_014480344.1 hypothetical protein -
  NX050_RS08575 (NX050_08575) - 1631860..1632165 (-) 306 WP_123772463.1 hypothetical protein -
  NX050_RS08580 (NX050_08580) terS 1632292..1632856 (+) 565 Protein_1682 phage terminase small subunit -
  NX050_RS08585 (NX050_08585) - 1632816..1633291 (+) 476 Protein_1683 phage tail tube protein -
  NX050_RS08590 (NX050_08590) - 1633578..1633664 (-) 87 WP_072592549.1 putative holin-like toxin -
  NX050_RS22555 - 1633839..1634005 (+) 167 Protein_1685 peptidoglycan-binding protein -
  NX050_RS08600 (NX050_08600) istB 1634257..1635015 (-) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  NX050_RS08605 (NX050_08605) istA 1635012..1636559 (-) 1548 WP_014480339.1 IS21 family transposase -
  NX050_RS08610 (NX050_08610) - 1637400..1637690 (-) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  NX050_RS08615 (NX050_08615) atxG 1637800..1638377 (-) 578 Protein_1689 suppressor of fused domain protein -
  NX050_RS08620 (NX050_08620) - 1638645..1638878 (-) 234 WP_224588641.1 hypothetical protein -
  NX050_RS08625 (NX050_08625) - 1638967..1639170 (+) 204 WP_123772462.1 hypothetical protein -
  NX050_RS08630 (NX050_08630) - 1639478..1639957 (-) 480 WP_224588637.1 hypothetical protein -
  NX050_RS08635 (NX050_08635) cdiI 1640062..1640421 (-) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  NX050_RS08640 (NX050_08640) - 1640518..1640970 (-) 453 WP_014480333.1 SMI1/KNR4 family protein -
  NX050_RS08645 (NX050_08645) - 1641069..1641509 (-) 441 WP_014480332.1 SMI1/KNR4 family protein -
  NX050_RS08650 (NX050_08650) - 1641912..1642199 (-) 288 WP_014480331.1 hypothetical protein -
  NX050_RS22560 (NX050_08655) - 1642213..1642920 (-) 708 WP_014480330.1 hypothetical protein -
  NX050_RS22565 (NX050_08660) - 1643306..1644139 (-) 834 Protein_1698 ribonuclease YeeF family protein -
  NX050_RS08665 (NX050_08665) - 1644321..1645448 (+) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  NX050_RS08675 (NX050_08675) - 1646188..1646583 (-) 396 WP_014480327.1 VOC family protein -
  NX050_RS08680 (NX050_08680) - 1647525..1648415 (-) 891 WP_014480326.1 LysR family transcriptional regulator -
  NX050_RS08685 (NX050_08685) fumC 1648582..1649970 (+) 1389 WP_014480325.1 class II fumarate hydratase -
  NX050_RS08690 (NX050_08690) - 1650189..1650401 (+) 213 Protein_1703 recombinase family protein -
  NX050_RS08695 (NX050_08695) - 1650398..1650496 (-) 99 WP_031600702.1 hypothetical protein -
  NX050_RS08700 (NX050_08700) sigK 1650496..1651224 (-) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  NX050_RS08705 (NX050_08705) nucA/comI 1651420..1651830 (+) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  NX050_RS08710 (NX050_08710) yqeB 1651863..1652585 (-) 723 WP_014480321.1 hypothetical protein -
  NX050_RS08715 (NX050_08715) gnd 1652836..1653729 (+) 894 WP_014480320.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  NX050_RS08720 (NX050_08720) yqeD 1653748..1654374 (-) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  NX050_RS08725 (NX050_08725) cwlH 1654561..1655313 (+) 753 WP_014480318.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  NX050_RS08730 (NX050_08730) yqeF 1655565..1656296 (+) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  NX050_RS08735 (NX050_08735) - 1656602..1656742 (-) 141 WP_003226124.1 sporulation histidine kinase inhibitor Sda -
  NX050_RS08740 (NX050_08740) yqeG 1657104..1657622 (+) 519 WP_003226126.1 YqeG family HAD IIIA-type phosphatase -
  NX050_RS08745 (NX050_08745) yqeH 1657626..1658726 (+) 1101 WP_003229966.1 ribosome biogenesis GTPase YqeH -
  NX050_RS08750 (NX050_08750) aroE 1658744..1659586 (+) 843 WP_014480317.1 shikimate dehydrogenase -
  NX050_RS08755 (NX050_08755) yhbY 1659580..1659870 (+) 291 WP_003226133.1 ribosome assembly RNA-binding protein YhbY -
  NX050_RS08760 (NX050_08760) nadD 1659882..1660451 (+) 570 WP_004398676.1 nicotinate-nucleotide adenylyltransferase -
  NX050_RS08765 (NX050_08765) yqeK 1660441..1661001 (+) 561 WP_014480316.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) YqeK -
  NX050_RS08770 (NX050_08770) rsfS 1661019..1661375 (+) 357 WP_014480315.1 ribosome silencing factor -
  NX050_RS08775 (NX050_08775) yqeM 1661372..1662115 (+) 744 WP_014480314.1 class I SAM-dependent methyltransferase -
  NX050_RS08780 (NX050_08780) comER 1662181..1663002 (-) 822 WP_014480313.1 late competence protein ComER -
  NX050_RS08785 (NX050_08785) comEA 1663086..1663703 (+) 618 WP_014480312.1 competence protein ComEA Machinery gene
  NX050_RS08790 (NX050_08790) comEB 1663770..1664339 (+) 570 WP_003229978.1 ComE operon protein 2 -
  NX050_RS08795 (NX050_08795) comEC 1664343..1666673 (+) 2331 WP_033881047.1 DNA internalization-related competence protein ComEC/Rec2 Machinery gene

Sequence

Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=722870 NX050_RS08705 WP_009967785.1 1651420..1651830(+) (nucA/comI) [Bacillus subtilis strain PN176 (HK176)]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=722870 NX050_RS08705 WP_009967785.1 1651420..1651830(+) (nucA/comI) [Bacillus subtilis strain PN176 (HK176)]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(40-130)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529