Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NX050_RS05735 Genome accession   NZ_CP103456
Coordinates   1088199..1088339 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain PN176 (HK176)     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1083199..1093339
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX050_RS05705 (NX050_05705) yueI 1083495..1083893 (+) 399 WP_014480710.1 YueI family protein -
  NX050_RS05710 (NX050_05710) pncA 1083990..1084541 (+) 552 WP_014480709.1 cysteine hydrolase family protein -
  NX050_RS05715 (NX050_05715) pncB 1084557..1086029 (+) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  NX050_RS05720 (NX050_05720) pdeH 1086165..1087394 (+) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  NX050_RS05725 (NX050_05725) - 1087370..1087738 (-) 369 WP_014477834.1 hypothetical protein -
  NX050_RS05730 (NX050_05730) - 1087852..1087977 (-) 126 WP_003228793.1 hypothetical protein -
  NX050_RS05735 (NX050_05735) degQ 1088199..1088339 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NX050_RS05740 (NX050_05740) - 1088524..1089387 (+) 864 WP_014480705.1 polyprenyl synthetase family protein -
  NX050_RS05745 (NX050_05745) comX 1089389..1089610 (+) 222 WP_014480704.1 competence pheromone ComX -
  NX050_RS05750 (NX050_05750) comP 1089626..1091938 (+) 2313 WP_014480703.1 sensor histidine kinase Regulator
  NX050_RS05755 (NX050_05755) comA 1092019..1092663 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NX050_RS05760 (NX050_05760) yuxO 1092682..1093062 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=722859 NX050_RS05735 WP_003220708.1 1088199..1088339(+) (degQ) [Bacillus subtilis strain PN176 (HK176)]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=722859 NX050_RS05735 WP_003220708.1 1088199..1088339(+) (degQ) [Bacillus subtilis strain PN176 (HK176)]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1