Detailed information NTG0722321

Bioinformatically predicted

Overview

• Name: degQ
• Type: Regulator
• Locus tag: NX823_RS16580
• Genome accession: NZ_CP103352
• Coordinates: 3091197..3091337 (-)
• Length: 46 a.a.
• NCBI ID: WP_003220708.1
• Uniprot ID: G4P060
• Organism: Bacillus subtilis strain SRCM117508
• Function: modification of regulators (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	3089718..3091070	3091197..3091337	flank	127

Gene organization within MGE regions

Location: 3089718..3091337

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NX823_RS16575 (NX823_16575)	-	3089718..3091070 (+)	1353	WP_014478984.1	IS1182 family transposase	-
NX823_RS16580 (NX823_16580)	degQ	3091197..3091337 (-)	141	WP_003220708.1	degradation enzyme regulation protein DegQ	Regulator

Sequence

Protein

• Length: 46 a.a.
• Molecular weight: 5546.44 Da
• Isoelectric Point: 6.2559

>NTDB_id=722321 NX823_RS16580 WP_003220708.1 3091197..3091337(-) (degQ) [Bacillus subtilis strain SRCM117508]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide

• Length: 141 bp

>NTDB_id=722321 NX823_RS16580 WP_003220708.1 3091197..3091337(-) (degQ) [Bacillus subtilis strain SRCM117508]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

• DegQ (SacQ) family (DegQ) (1-46)

3D structure

• AlphaFold DB: G4P060

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
degQ	Bacillus subtilis subsp. subtilis str. 168	100	100	1