Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   NX823_RS13270 Genome accession   NZ_CP103352
Coordinates   2487224..2487634 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain SRCM117508     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2478749..2509063 2487224..2487634 within 0
IS/Tn 2485739..2487091 2487224..2487634 flank 133


Gene organization within MGE regions


Location: 2478749..2509063
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX823_RS13225 (NX823_13225) yqeH 2478749..2479849 (-) 1101 WP_003229966.1 ribosome biogenesis GTPase YqeH -
  NX823_RS13230 (NX823_13230) yqeG 2479853..2480371 (-) 519 WP_003226126.1 YqeG family HAD IIIA-type phosphatase -
  NX823_RS13235 (NX823_13235) - 2480733..2480873 (+) 141 WP_003226124.1 sporulation histidine kinase inhibitor Sda -
  NX823_RS13240 (NX823_13240) yqeF 2481179..2481910 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  NX823_RS13245 (NX823_13245) cwlH 2482162..2482914 (-) 753 WP_069837642.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  NX823_RS13250 (NX823_13250) yqeD 2483101..2483727 (+) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  NX823_RS13255 (NX823_13255) gnd 2483746..2484639 (-) 894 WP_069837643.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  NX823_RS13260 (NX823_13260) yqeB 2484890..2485612 (+) 723 WP_014480321.1 hypothetical protein -
  NX823_RS13265 (NX823_13265) - 2485739..2487091 (+) 1353 WP_014478984.1 IS1182 family transposase -
  NX823_RS13270 (NX823_13270) nucA/comI 2487224..2487634 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  NX823_RS13275 (NX823_13275) sigK 2487830..2488558 (+) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  NX823_RS13280 (NX823_13280) - 2488558..2488656 (+) 99 WP_031600702.1 hypothetical protein -
  NX823_RS13285 (NX823_13285) - 2488653..2488865 (-) 213 Protein_2569 recombinase family protein -
  NX823_RS13290 (NX823_13290) fumC 2489084..2490472 (-) 1389 WP_014480325.1 class II fumarate hydratase -
  NX823_RS13295 (NX823_13295) - 2490639..2491529 (+) 891 WP_014480326.1 LysR family transcriptional regulator -
  NX823_RS13300 (NX823_13300) - 2492471..2492866 (+) 396 WP_046160622.1 VOC family protein -
  NX823_RS13310 (NX823_13310) - 2493606..2494733 (-) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  NX823_RS22075 (NX823_13315) - 2494915..2495748 (+) 834 Protein_2574 ribonuclease YeeF family protein -
  NX823_RS22080 (NX823_13320) - 2496134..2496841 (+) 708 WP_014480330.1 hypothetical protein -
  NX823_RS13325 (NX823_13325) - 2496855..2497142 (+) 288 WP_014480331.1 hypothetical protein -
  NX823_RS13330 (NX823_13330) - 2497545..2497985 (+) 441 WP_014480332.1 SMI1/KNR4 family protein -
  NX823_RS13335 (NX823_13335) - 2498084..2498536 (+) 453 WP_014480333.1 SMI1/KNR4 family protein -
  NX823_RS13340 (NX823_13340) cdiI 2498633..2498992 (+) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  NX823_RS13345 (NX823_13345) - 2499097..2499576 (+) 480 WP_224588637.1 hypothetical protein -
  NX823_RS13350 (NX823_13350) - 2499884..2500087 (-) 204 WP_123772462.1 hypothetical protein -
  NX823_RS13355 (NX823_13355) - 2500176..2500409 (+) 234 WP_224588641.1 hypothetical protein -
  NX823_RS13360 (NX823_13360) atxG 2500677..2501254 (+) 578 Protein_2583 suppressor of fused domain protein -
  NX823_RS13365 (NX823_13365) - 2501364..2501654 (+) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  NX823_RS22085 - 2502563..2502729 (-) 167 Protein_2585 peptidoglycan-binding protein -
  NX823_RS13375 (NX823_13375) - 2502904..2502990 (+) 87 WP_072592549.1 putative holin-like toxin -
  NX823_RS22090 - 2503277..2503752 (-) 476 Protein_2587 phage tail tube protein -
  NX823_RS13390 (NX823_13390) terS 2503712..2504276 (-) 565 Protein_2588 phage terminase small subunit -
  NX823_RS13395 (NX823_13395) - 2504403..2504708 (+) 306 WP_123772463.1 hypothetical protein -
  NX823_RS13405 (NX823_13405) - 2505101..2505580 (-) 480 WP_014480344.1 hypothetical protein -
  NX823_RS13410 (NX823_13410) - 2506197..2506463 (+) 267 WP_033881358.1 hypothetical protein -
  NX823_RS13415 (NX823_13415) - 2506602..2506754 (-) 153 WP_049832653.1 XtrA/YqaO family protein -
  NX823_RS13420 (NX823_13420) - 2506837..2506959 (-) 123 Protein_2593 RusA family crossover junction endodeoxyribonuclease -
  NX823_RS13425 (NX823_13425) - 2506922..2507170 (-) 249 Protein_2594 hypothetical protein -
  NX823_RS13430 (NX823_13430) - 2507315..2507545 (-) 231 WP_224588644.1 hypothetical protein -
  NX823_RS13435 (NX823_13435) - 2507854..2508034 (-) 181 Protein_2596 hypothetical protein -
  NX823_RS13440 (NX823_13440) bltR 2508242..2509063 (-) 822 WP_014480349.1 multidrug efflux transcriptional regulator BltR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=722310 NX823_RS13270 WP_009967785.1 2487224..2487634(-) (nucA/comI) [Bacillus subtilis strain SRCM117508]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=722310 NX823_RS13270 WP_009967785.1 2487224..2487634(-) (nucA/comI) [Bacillus subtilis strain SRCM117508]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529