Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NX062_RS12285 Genome accession   NZ_CP103328
Coordinates   2303678..2303851 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain KC14-1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2298678..2308851
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX062_RS12270 (NX062_12265) gcvT 2299477..2300565 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  NX062_RS12275 (NX062_12270) hepAA 2301007..2302680 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  NX062_RS12280 (NX062_12275) yqhG 2302701..2303495 (+) 795 WP_014480249.1 YqhG family protein -
  NX062_RS12285 (NX062_12280) sinI 2303678..2303851 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NX062_RS12290 (NX062_12285) sinR 2303885..2304220 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NX062_RS12295 (NX062_12290) tasA 2304313..2305098 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  NX062_RS12300 (NX062_12295) sipW 2305162..2305734 (-) 573 WP_003230181.1 signal peptidase I SipW -
  NX062_RS12305 (NX062_12300) tapA 2305718..2306479 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  NX062_RS12310 (NX062_12305) yqzG 2306751..2307077 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NX062_RS12315 (NX062_12310) spoIITA 2307119..2307298 (-) 180 WP_029726723.1 YqzE family protein -
  NX062_RS12320 (NX062_12315) comGG 2307370..2307744 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NX062_RS12325 (NX062_12320) comGF 2307745..2308128 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  NX062_RS12330 (NX062_12325) comGE 2308154..2308501 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=721982 NX062_RS12285 WP_003230187.1 2303678..2303851(+) (sinI) [Bacillus subtilis strain KC14-1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=721982 NX062_RS12285 WP_003230187.1 2303678..2303851(+) (sinI) [Bacillus subtilis strain KC14-1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1