Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NXS96_RS13400 Genome accession   NZ_CP103066
Coordinates   2556138..2556521 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain 0137     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551138..2561521
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NXS96_RS13360 (NXS96_13360) sinI 2552072..2552245 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NXS96_RS13365 (NXS96_13365) sinR 2552279..2552614 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NXS96_RS13370 (NXS96_13370) tasA 2552707..2553492 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  NXS96_RS13375 (NXS96_13375) sipW 2553556..2554128 (-) 573 WP_003246088.1 signal peptidase I SipW -
  NXS96_RS13380 (NXS96_13380) tapA 2554112..2554873 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  NXS96_RS13385 (NXS96_13385) yqzG 2555145..2555471 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NXS96_RS13390 (NXS96_13390) spoIITA 2555513..2555692 (-) 180 WP_003230176.1 YqzE family protein -
  NXS96_RS13395 (NXS96_13395) comGG 2555763..2556137 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  NXS96_RS13400 (NXS96_13400) comGF 2556138..2556521 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  NXS96_RS13405 (NXS96_13405) comGE 2556547..2556894 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  NXS96_RS13410 (NXS96_13410) comGD 2556878..2557309 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  NXS96_RS13415 (NXS96_13415) comGC 2557299..2557595 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NXS96_RS13420 (NXS96_13420) comGB 2557609..2558646 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  NXS96_RS13425 (NXS96_13425) comGA 2558633..2559703 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NXS96_RS13430 (NXS96_13430) corA 2560115..2561068 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=721343 NXS96_RS13400 WP_003230168.1 2556138..2556521(-) (comGF) [Bacillus subtilis strain 0137]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=721343 NXS96_RS13400 WP_003230168.1 2556138..2556521(-) (comGF) [Bacillus subtilis strain 0137]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1