Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | EL334_RS02760 | Genome accession | NZ_AP019192 |
| Coordinates | 507590..507739 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain ASP0581 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 502590..512739
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL334_RS02725 (ASP0581_05060) | blpC | 502772..502927 (-) | 156 | WP_000358814.1 | quorum-sensing system pheromone BlpC | - |
| EL334_RS02730 (ASP0581_05070) | - | 502984..504345 (-) | 1362 | WP_033705510.1 | bacteriocin secretion accessory protein | - |
| EL334_RS02735 (ASP0581_05080) | comA/nlmT | 504356..506032 (-) | 1677 | WP_332066666.1 | peptide cleavage/export ABC transporter | Regulator |
| EL334_RS12570 (ASP0581_05090) | comA/nlmT | 505926..506513 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| EL334_RS02745 (ASP0581_05100) | blpM | 506873..507127 (+) | 255 | WP_033705509.1 | two-peptide bacteriocin subunit BlpM | - |
| EL334_RS02750 (ASP0581_05110) | blpN | 507143..507346 (+) | 204 | WP_001099490.1 | two-peptide bacteriocin subunit BlpN | - |
| EL334_RS02760 (ASP0581_05120) | cipB | 507590..507739 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| EL334_RS02765 | - | 507843..507962 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| EL334_RS02775 (ASP0581_05140) | - | 508430..508801 (+) | 372 | WP_033705507.1 | hypothetical protein | - |
| EL334_RS11770 | - | 508962..509931 (+) | 970 | Protein_520 | thioredoxin domain-containing protein | - |
| EL334_RS02790 (ASP0581_05170) | - | 510178..510411 (+) | 234 | WP_033705506.1 | bacteriocin class II family protein | - |
| EL334_RS02795 (ASP0581_05180) | - | 510443..511132 (+) | 690 | WP_033705505.1 | CPBP family intramembrane glutamic endopeptidase | - |
| EL334_RS02800 (ASP0581_05190) | blpZ | 511174..511422 (+) | 249 | WP_000276506.1 | immunity protein BlpZ | - |
| EL334_RS02805 | - | 511452..512063 (+) | 612 | WP_000394042.1 | CPBP family intramembrane glutamic endopeptidase | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=72124 EL334_RS02760 WP_001809846.1 507590..507739(+) (cipB) [Streptococcus pneumoniae strain ASP0581]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=72124 EL334_RS02760 WP_001809846.1 507590..507739(+) (cipB) [Streptococcus pneumoniae strain ASP0581]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |