Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   NVS73_RS17210 Genome accession   NZ_CP102769
Coordinates   3255448..3255615 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain YZSR384     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250448..3260615
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NVS73_RS17180 (NVS73_17185) mrpE 3250844..3251320 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  NVS73_RS17185 (NVS73_17190) mrpF 3251320..3251604 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  NVS73_RS17190 (NVS73_17195) mnhG 3251588..3251962 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  NVS73_RS17195 (NVS73_17200) yuxO 3252001..3252381 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NVS73_RS17200 (NVS73_17205) comA 3252400..3253044 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NVS73_RS17205 (NVS73_17210) comP 3253125..3255433 (-) 2309 Protein_3325 two-component system sensor histidine kinase ComP -
  NVS73_RS17210 (NVS73_17215) comX 3255448..3255615 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  NVS73_RS17215 (NVS73_17220) comQ 3255603..3256502 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  NVS73_RS17220 (NVS73_17225) degQ 3256687..3256827 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NVS73_RS17225 (NVS73_17230) - 3257049..3257174 (+) 126 WP_003228793.1 hypothetical protein -
  NVS73_RS17230 (NVS73_17235) - 3257288..3257656 (+) 369 WP_003243784.1 hypothetical protein -
  NVS73_RS17235 (NVS73_17240) pdeH 3257632..3258861 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NVS73_RS17240 (NVS73_17245) pncB 3258998..3260470 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=718944 NVS73_RS17210 WP_003242801.1 3255448..3255615(-) (comX) [Bacillus subtilis strain YZSR384]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=718944 NVS73_RS17210 WP_003242801.1 3255448..3255615(-) (comX) [Bacillus subtilis strain YZSR384]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1