Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NVS73_RS13345 Genome accession   NZ_CP102769
Coordinates   2552039..2552212 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain YZSR384     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2547039..2557212
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NVS73_RS13330 (NVS73_13335) gcvT 2547838..2548926 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  NVS73_RS13335 (NVS73_13340) yqhH 2549368..2551041 (+) 1674 WP_004398544.1 SNF2-related protein -
  NVS73_RS13340 (NVS73_13345) yqhG 2551062..2551856 (+) 795 WP_003230200.1 YqhG family protein -
  NVS73_RS13345 (NVS73_13350) sinI 2552039..2552212 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NVS73_RS13350 (NVS73_13355) sinR 2552246..2552581 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NVS73_RS13355 (NVS73_13360) tasA 2552674..2553459 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  NVS73_RS13360 (NVS73_13365) sipW 2553523..2554095 (-) 573 WP_003246088.1 signal peptidase I -
  NVS73_RS13365 (NVS73_13370) tapA 2554079..2554840 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  NVS73_RS13370 (NVS73_13375) yqzG 2555112..2555438 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NVS73_RS13375 (NVS73_13380) spoIIT 2555480..2555659 (-) 180 WP_003230176.1 YqzE family protein -
  NVS73_RS13380 (NVS73_13385) comGG 2555730..2556104 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  NVS73_RS13385 (NVS73_13390) comGF 2556105..2556488 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  NVS73_RS13390 (NVS73_13395) comGE 2556514..2556861 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=718921 NVS73_RS13345 WP_003230187.1 2552039..2552212(+) (sinI) [Bacillus subtilis strain YZSR384]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=718921 NVS73_RS13345 WP_003230187.1 2552039..2552212(+) (sinI) [Bacillus subtilis strain YZSR384]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1