Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NR984_RS13245 Genome accession   NZ_CP102663
Coordinates   2557732..2557908 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus sp. BAC     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2552732..2562908
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NR984_RS13230 (NR984_13230) gcvT 2553374..2554468 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  NR984_RS13235 (NR984_13235) - 2555061..2556740 (+) 1680 WP_003183439.1 DEAD/DEAH box helicase -
  NR984_RS13240 (NR984_13240) - 2556747..2557541 (+) 795 WP_003183441.1 YqhG family protein -
  NR984_RS13245 (NR984_13245) sinI 2557732..2557908 (+) 177 WP_003183444.1 anti-repressor SinI Regulator
  NR984_RS13250 (NR984_13250) sinR 2557942..2558277 (+) 336 WP_025804940.1 transcriptional regulator SinR Regulator
  NR984_RS13255 (NR984_13255) tasA 2558382..2559176 (-) 795 WP_003183447.1 biofilm matrix protein TasA -
  NR984_RS13260 (NR984_13260) sipW 2559250..2559834 (-) 585 WP_003183449.1 signal peptidase I SipW -
  NR984_RS13265 (NR984_13265) tapA 2559831..2560559 (-) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  NR984_RS13270 (NR984_13270) - 2560836..2561156 (+) 321 WP_003183454.1 YqzG/YhdC family protein -
  NR984_RS13275 (NR984_13275) - 2561186..2561368 (-) 183 WP_003183456.1 YqzE family protein -
  NR984_RS13280 (NR984_13280) comGG 2561457..2561822 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  NR984_RS13285 (NR984_13285) comGF 2561835..2562323 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  NR984_RS13290 (NR984_13290) comGE 2562232..2562579 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=718276 NR984_RS13245 WP_003183444.1 2557732..2557908(+) (sinI) [Bacillus sp. BAC]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=718276 NR984_RS13245 WP_003183444.1 2557732..2557908(+) (sinI) [Bacillus sp. BAC]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517