NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	NUU05_RS01740	Genome accession	NZ_CP102538
Coordinates	307098..307490 (+)	Length	130 a.a.
NCBI ID	WP_011227579.1	Uniprot ID	A0A2S4DWC9
Organism	Streptococcus thermophilus strain TH-4
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 302098..312490

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NUU05_RS01705 (NUU05_01695)	proC	302301..303071 (-)	771	WP_011226616.1	pyrroline-5-carboxylate reductase	-
NUU05_RS01710 (NUU05_01700)	pepA	303087..304154 (-)	1068	WP_002952022.1	glutamyl aminopeptidase	-
NUU05_RS01715 (NUU05_01705)	-	304254..304538 (+)	285	WP_011681678.1	DUF4651 domain-containing protein	-
NUU05_RS01720 (NUU05_01710)	-	304535..304849 (+)	315	WP_011226613.1	thioredoxin family protein	-
NUU05_RS01725 (NUU05_01715)	ytpR	304859..305482 (+)	624	WP_002952017.1	YtpR family tRNA-binding protein	-
NUU05_RS01730 (NUU05_01720)	-	305620..306651 (+)	1032	WP_011681677.1	YeeE/YedE family protein	-
NUU05_RS01735 (NUU05_01725)	-	306666..306893 (+)	228	WP_003095911.1	sulfurtransferase TusA family protein	-
NUU05_RS01740 (NUU05_01730)	ssbA	307098..307490 (+)	393	WP_011227579.1	single-stranded DNA-binding protein	Machinery gene
NUU05_RS01745 (NUU05_01735)	tadA	308251..308769 (+)	519	WP_011681675.1	tRNA adenosine(34) deaminase TadA	-
NUU05_RS01750 (NUU05_01740)	-	308850..309113 (-)	264	WP_011681674.1	hypothetical protein	-
NUU05_RS01755 (NUU05_01745)	-	309166..309333 (-)	168	WP_011681673.1	class IIb bacteriocin, lactobin A/cerein 7B family	-
NUU05_RS01765 (NUU05_01755)	-	309702..310535 (+)	834	WP_011681672.1	putative RNA methyltransferase	-
NUU05_RS09745	-	310650..311405 (+)	756	Protein_290	HAD family hydrolase	-
NUU05_RS01780 (NUU05_01770)	dapD	311491..312189 (+)	699	WP_002951996.1	2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase	-

Sequence

Protein

Download Length: 130 a.a. Molecular weight: 14773.70 Da Isoelectric Point: 5.9275

                                >NTDB_id=717613 NUU05_RS01740 WP_011227579.1 307098..307490(+) (ssbA) [Streptococcus thermophilus strain TH-4]

MYNKVILIGRLTATPEMVKTASDRSFTRVTVAVNRRYKTQNGEREADFITVVVWGRLAETLASYASKGSLISLDGELRTR

KYDKDGQTHYVTEVLCSSFQLLESRAQRAVRENNPDNDLADLILEEELPF

Nucleotide

Download Length: 393 bp

                                >NTDB_id=717613 NUU05_RS01740 WP_011227579.1 307098..307490(+) (ssbA) [Streptococcus thermophilus strain TH-4]

ATGTATAACAAAGTAATTTTAATTGGACGTTTAACAGCTACTCCTGAAATGGTTAAGACTGCTAGCGATAGGTCTTTTAC

ACGTGTCACAGTTGCGGTTAATCGTCGCTATAAGACGCAAAATGGTGAGCGTGAGGCTGACTTTATTACAGTGGTTGTCT

GGGGGCGTTTGGCTGAGACCTTAGCCTCTTATGCTAGCAAGGGGAGTTTAATTTCTCTTGATGGTGAGCTTCGCACTCGT

AAGTATGATAAGGATGGTCAAACTCATTACGTTACTGAAGTGCTTTGTTCCTCTTTCCAACTTCTGGAGAGTCGTGCTCA

GCGTGCTGTTAGGGAAAATAATCCTGACAATGACTTGGCTGACCTGATTTTAGAAGAAGAGCTTCCCTTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(3-102)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A2S4DWC9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Streptococcus mutans UA159	80.153	100	0.808
ssbB/cilA	Streptococcus pneumoniae TIGR4	75.573	100	0.762
ssbB	Streptococcus sobrinus strain NIDR 6715-7	75.573	100	0.762
ssbB/cilA	Streptococcus mitis SK321	74.809	100	0.754
ssbB/cilA	Streptococcus pneumoniae R6	74.809	100	0.754
ssbB/cilA	Streptococcus pneumoniae Rx1	74.809	100	0.754
ssbB/cilA	Streptococcus pneumoniae D39	74.809	100	0.754
ssbB/cilA	Streptococcus mitis NCTC 12261	73.282	100	0.738
ssbB	Lactococcus lactis subsp. cremoris KW2	61.607	86.154	0.531
ssbA	Bacillus subtilis subsp. subtilis str. 168	48.113	81.538	0.392
ssb	Latilactobacillus sakei subsp. sakei 23K	47.17	81.538	0.385

Detailed information NTG0717613