Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   MCREHEC_RS05165 Genome accession   NZ_AP018796
Coordinates   1090932..1091516 (+) Length   194 a.a.
NCBI ID   WP_077825616.1    Uniprot ID   -
Organism   Escherichia coli strain E2855     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1074677..1113406 1090932..1091516 within 0


Gene organization within MGE regions


Location: 1074677..1113406
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MCREHEC_RS05100 (E2855_01008) zapC 1075701..1076243 (+) 543 WP_001295353.1 cell division protein ZapC -
  MCREHEC_RS05105 (E2855_01009) ycbX 1076240..1077349 (-) 1110 WP_000224312.1 6-N-hydroxylaminopurine resistance protein YcbX -
  MCREHEC_RS05110 (E2855_01010) rlmKL 1077593..1079701 (+) 2109 WP_001086519.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  MCREHEC_RS05115 (E2855_01011) uup 1079713..1081620 (+) 1908 WP_000053122.1 ABC transporter ATP-binding protein -
  MCREHEC_RS05120 (E2855_01012) pqiA 1081750..1083003 (+) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  MCREHEC_RS05125 (E2855_01013) pqiB 1083008..1084648 (+) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  MCREHEC_RS05130 (E2855_01014) pqiC 1084645..1085208 (+) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  MCREHEC_RS05135 (E2855_01015) rmf 1085464..1085631 (+) 168 WP_000828648.1 ribosome modulation factor -
  MCREHEC_RS05140 (E2855_01016) fabA 1085701..1086219 (-) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  MCREHEC_RS05145 (E2855_01017) ycbZ 1086288..1088048 (-) 1761 WP_000156528.1 Lon protease family protein -
  MCREHEC_RS05150 (E2855_01018) matP 1088234..1088686 (+) 453 WP_000877161.1 macrodomain Ter protein MatP -
  MCREHEC_RS05155 (E2855_01019) ompA 1088762..1089802 (-) 1041 WP_000750416.1 porin OmpA -
  MCREHEC_RS05160 (E2855_01020) sulA 1090159..1090668 (-) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  MCREHEC_RS05165 (E2855_01021) sxy/tfoX 1090932..1091516 (+) 585 WP_077825616.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  MCREHEC_RS05170 (E2855_01022) yccS 1091479..1093641 (-) 2163 WP_000875023.1 YccS family putative transporter -
  MCREHEC_RS05175 (E2855_01023) yccF 1093651..1094097 (-) 447 WP_001261235.1 YccF domain-containing protein -
  MCREHEC_RS05180 (E2855_01024) helD 1094220..1096274 (+) 2055 WP_001297106.1 DNA helicase IV -
  MCREHEC_RS05185 (E2855_01025) mgsA 1096306..1096764 (-) 459 WP_000424181.1 methylglyoxal synthase -
  MCREHEC_RS05190 (E2855_01026) yccT 1096860..1097522 (-) 663 WP_000847791.1 DUF2057 family protein -
  MCREHEC_RS05195 (E2855_01027) yccU 1097695..1098108 (+) 414 WP_000665217.1 CoA-binding protein -
  MCREHEC_RS05200 (E2855_01028) hspQ 1098153..1098470 (-) 318 WP_001295356.1 heat shock protein HspQ -
  MCREHEC_RS05205 (E2855_01029) rlmI 1098528..1099718 (-) 1191 WP_000116302.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  MCREHEC_RS05210 yccX 1099813..1100090 (+) 278 Protein_1018 acylphosphatase -
  MCREHEC_RS05215 (E2855_01032) tusE 1100087..1100416 (-) 330 WP_000904442.1 sulfurtransferase TusE -
  MCREHEC_RS05220 (E2855_01033) yccA 1100507..1101166 (-) 660 WP_000375138.1 FtsH protease modulator YccA -
  MCREHEC_RS05230 (E2855_01035) - 1101574..1102589 (-) 1016 Protein_1021 tyrosine-type recombinase/integrase -
  MCREHEC_RS05235 (E2855_01036) - 1102567..1102809 (-) 243 WP_000273151.1 DUF4224 domain-containing protein -
  MCREHEC_RS05240 (E2855_01037) - 1102877..1103929 (-) 1053 Protein_1023 3'-5' exoribonuclease -
  MCREHEC_RS05255 (E2855_01040) - 1105240..1106661 (-) 1422 Protein_1025 exonuclease -
  MCREHEC_RS05260 (E2855_01041) - 1106754..1106945 (-) 192 WP_001090200.1 DUF1482 family protein -
  MCREHEC_RS05265 (E2855_01042) dicB 1106942..1107130 (-) 189 WP_000449192.1 cell division inhibition protein DicB -
  MCREHEC_RS05270 (E2855_01043) - 1107662..1108036 (-) 375 WP_000394557.1 hypothetical protein -
  MCREHEC_RS05275 (E2855_01044) - 1108048..1108200 (-) 153 WP_000379580.1 DUF1391 family protein -
  MCREHEC_RS05285 (E2855_01045) - 1108473..1109189 (-) 717 WP_000103686.1 S24 family peptidase -
  MCREHEC_RS05290 (E2855_01046) - 1109239..1109454 (+) 216 WP_000471549.1 Cro/CI family transcriptional regulator -
  MCREHEC_RS05295 (E2855_01047) - 1109451..1109876 (+) 426 WP_000693949.1 toxin YdaT family protein -
  MCREHEC_RS05300 (E2855_01048) - 1109948..1111018 (+) 1071 WP_001262389.1 hypothetical protein -
  MCREHEC_RS05305 (E2855_01049) - 1111059..1111481 (+) 423 WP_001151153.1 DUF977 family protein -
  MCREHEC_RS05310 (E2855_01050) - 1111478..1111774 (+) 297 WP_001266135.1 DUF4406 domain-containing protein -
  MCREHEC_RS05315 (E2855_01051) - 1111771..1112232 (+) 462 WP_001209481.1 sigma-E factor regulatory protein RseB domain-containing protein -
  MCREHEC_RS05320 (E2855_01052) - 1112210..1112566 (+) 357 WP_000403777.1 hypothetical protein -
  MCREHEC_RS05325 (E2855_01053) - 1112617..1112829 (+) 213 WP_000935420.1 hypothetical protein -
  MCREHEC_RS05330 - 1112862..1113079 (+) 218 Protein_1039 DUF4014 family protein -
  MCREHEC_RS05335 (E2855_01054) - 1113081..1113344 (+) 264 WP_000224233.1 hypothetical protein -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 22258.82 Da        Isoelectric Point: 8.4565

>NTDB_id=71456 MCREHEC_RS05165 WP_077825616.1 1090932..1091516(+) (sxy/tfoX) [Escherichia coli strain E2855]
MATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKL
VRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAI
IGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 585 bp        

>NTDB_id=71456 MCREHEC_RS05165 WP_077825616.1 1090932..1091516(+) (sxy/tfoX) [Escherichia coli strain E2855]
CTGGCAACGTTGGGCACAATTGAATACCGATCATTGTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGAT
GGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTGAGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGA
CATATAAAAAGTGTGGCCGATCCGTTACCCTCAATTACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTG
GTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCTGAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTT
GCCCAATATGTCTTTTCATCTGGAAGCGATTCTCGGGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGG
CAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAACAGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATT
ATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACGCCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACA
GGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX C-terminal domain (TfoX_C)

(101-179)

TfoX N-terminal domain (TfoX_N)

(2-91)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

99.485

100

0.995

Multiple sequence alignment