Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   NOO60_RS11440 Genome accession   NZ_CP102086
Coordinates   2484572..2484712 (-) Length   46 a.a.
NCBI ID   WP_346772044.1    Uniprot ID   -
Organism   Proteus mirabilis strain MN029     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 2473050..2495883 2484572..2484712 within 0


Gene organization within MGE regions


Location: 2473050..2495883
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NOO60_RS11350 - 2473050..2473967 (-) 918 WP_064505921.1 hypothetical protein -
  NOO60_RS11355 - 2474372..2474806 (-) 435 WP_017827666.1 hypothetical protein -
  NOO60_RS11360 - 2475202..2475750 (-) 549 WP_017827667.1 SMI1/KNR4 family protein -
  NOO60_RS11365 - 2475757..2475834 (-) 78 WP_230957016.1 hypothetical protein -
  NOO60_RS11370 - 2475942..2476391 (-) 450 WP_277258748.1 hypothetical protein -
  NOO60_RS11375 - 2476417..2477430 (-) 1014 WP_277247402.1 hypothetical protein -
  NOO60_RS11380 - 2477493..2478512 (-) 1020 WP_277258749.1 hypothetical protein -
  NOO60_RS11385 - 2478958..2479187 (-) 230 Protein_2218 transposase -
  NOO60_RS11390 - 2479431..2479850 (-) 420 WP_020945434.1 hypothetical protein -
  NOO60_RS11395 - 2479860..2480312 (-) 453 Protein_2220 RHS repeat-associated core domain-containing protein -
  NOO60_RS11400 - 2480379..2480750 (-) 372 WP_223852283.1 RHS domain-containing protein -
  NOO60_RS11405 - 2480910..2481365 (-) 456 WP_195569559.1 hypothetical protein -
  NOO60_RS11410 - 2481840..2482067 (-) 228 WP_259605280.1 immunity 22 family protein -
  NOO60_RS11415 - 2482238..2482456 (-) 219 WP_004244649.1 hypothetical protein -
  NOO60_RS11420 - 2482495..2482662 (-) 168 WP_155115351.1 hypothetical protein -
  NOO60_RS11425 - 2482737..2483159 (-) 423 WP_004244647.1 hypothetical protein -
  NOO60_RS11430 - 2483173..2483466 (-) 294 WP_072021553.1 GH-E family nuclease -
  NOO60_RS11435 - 2484051..2484560 (-) 510 WP_049212215.1 DUF6707 family protein -
  NOO60_RS11440 nucA/comI 2484572..2484712 (-) 141 WP_346772044.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene
  NOO60_RS18270 - 2484935..2485135 (-) 201 Protein_2230 RHS repeat-associated core domain-containing protein -
  NOO60_RS11445 - 2485397..2485864 (-) 468 WP_036920051.1 hypothetical protein -
  NOO60_RS11450 - 2485869..2486252 (-) 384 WP_277247409.1 hypothetical protein -
  NOO60_RS11455 - 2486415..2488760 (-) 2346 WP_283533631.1 RHS domain-containing protein -
  NOO60_RS11460 - 2488936..2489499 (-) 564 WP_017628424.1 hypothetical protein -
  NOO60_RS11465 - 2489496..2489843 (-) 348 WP_235046428.1 AHH domain-containing protein -
  NOO60_RS11470 - 2490021..2490218 (-) 198 WP_255320217.1 hypothetical protein -
  NOO60_RS11475 - 2490375..2490731 (-) 357 WP_017628426.1 hypothetical protein -
  NOO60_RS11480 - 2490740..2494183 (-) 3444 WP_283533632.1 RHS repeat-associated core domain-containing protein -
  NOO60_RS11485 - 2494236..2495444 (-) 1209 WP_283533633.1 transposase -
  NOO60_RS11490 tnpA 2495467..2495883 (+) 417 WP_283533634.1 IS200/IS605 family transposase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 4826.52 Da        Isoelectric Point: 9.7833

>NTDB_id=714195 NOO60_RS11440 WP_346772044.1 2484572..2484712(-) (nucA/comI) [Proteus mirabilis strain MN029]
MAMFKEGGKGASVRYISISDNRGAGSSISHALSPYPDGTKVKIIVE

Nucleotide


Download         Length: 141 bp        

>NTDB_id=714195 NOO60_RS11440 WP_346772044.1 2484572..2484712(-) (nucA/comI) [Proteus mirabilis strain MN029]
ATGGCTATGTTTAAAGAAGGGGGAAAAGGAGCGAGTGTAAGATATATTAGTATTAGTGATAATAGAGGTGCAGGTTCTTC
TATATCTCATGCATTATCCCCTTATCCTGATGGAACAAAAGTAAAAATTATTGTGGAATAA

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(2-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

65.217

100

0.652