Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   PPM34_RS14920 Genome accession   NZ_CP116869
Coordinates   2894729..2894869 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain MGP001     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2889729..2899869
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM34_RS14895 yuxO 2890042..2890422 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  PPM34_RS14900 comA 2890441..2891085 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PPM34_RS14905 comP 2891166..2893475 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  PPM34_RS14910 comX 2893490..2893657 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  PPM34_RS14915 comQ 2893645..2894544 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  PPM34_RS14920 degQ 2894729..2894869 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PPM34_RS14925 - 2895091..2895216 (+) 126 WP_003228793.1 hypothetical protein -
  PPM34_RS14930 - 2895330..2895698 (+) 369 WP_003243784.1 hypothetical protein -
  PPM34_RS14935 pdeH 2895674..2896903 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  PPM34_RS14940 pncB 2897040..2898512 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  PPM34_RS14945 pncA 2898528..2899079 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  PPM34_RS14950 yueI 2899176..2899574 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=713739 PPM34_RS14920 WP_003220708.1 2894729..2894869(-) (degQ) [Bacillus subtilis subsp. subtilis strain MGP001]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=713739 PPM34_RS14920 WP_003220708.1 2894729..2894869(-) (degQ) [Bacillus subtilis subsp. subtilis strain MGP001]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1