Detailed information NTG0713496

Bioinformatically predicted

Overview

• Name: rcrR
• Type: Regulator
• Locus tag: NPS18_RS04320
• Genome accession: NZ_CP101984
• Coordinates: 874395..874829 (+)
• Length: 144 a.a.
• NCBI ID: WP_002263292.1
• Uniprot ID: A0AAX1K4B8
• Organism: Streptococcus mutans strain UA-159
• Function: regulate competence (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	855561..878379	874395..874829	within	0

Gene organization within MGE regions

Location: 855561..878379

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NPS18_RS04255 (NPS18_04255)	-	855561..856766 (+)	1206	WP_002262894.1	CCA tRNA nucleotidyltransferase	-
NPS18_RS04260 (NPS18_04260)	-	856769..858637 (+)	1869	WP_002262895.1	ABC-F family ATP-binding cassette domain-containing protein	-
NPS18_RS04265 (NPS18_04265)	-	859094..860830 (+)	1737	WP_002262897.1	ABC transporter ATP-binding protein	-
NPS18_RS04270 (NPS18_04270)	-	860841..862613 (+)	1773	WP_002262898.1	ABC transporter ATP-binding protein	-
NPS18_RS04275 (NPS18_04275)	-	862729..863649 (+)	921	WP_002262899.1	AEC family transporter	-
NPS18_RS04280 (NPS18_04280)	gtfD	863869..868257 (+)	4389	WP_002352262.1	glucosyltransferase-S	-
NPS18_RS04285 (NPS18_04285)	-	868432..868941 (-)	510	WP_002262901.1	DUF308 domain-containing protein	-
NPS18_RS04290 (NPS18_04290)	gdhA	869577..870926 (+)	1350	WP_002263849.1	NADP-specific glutamate dehydrogenase	-
NPS18_RS04295 (NPS18_04295)	-	871038..871421 (-)	384	WP_002263287.1	DUF3021 family protein	-
NPS18_RS04300 (NPS18_04300)	queF	871530..872018 (-)	489	WP_002263288.1	preQ(1) synthase	-
NPS18_RS04305 (NPS18_04305)	queE	872031..872747 (-)	717	WP_002263289.1	7-carboxy-7-deazaguanine synthase QueE	-
NPS18_RS04310 (NPS18_04310)	queD	872744..873190 (-)	447	WP_002263290.1	6-carboxytetrahydropterin synthase QueD	-
NPS18_RS04315 (NPS18_04315)	queC	873190..873843 (-)	654	WP_002263291.1	7-cyano-7-deazaguanine synthase QueC	-
NPS18_RS04320 (NPS18_04320)	rcrR	874395..874829 (+)	435	WP_002263292.1	MarR family winged helix-turn-helix transcriptional regulator	Regulator
NPS18_RS04325 (NPS18_04325)	rcrP	874833..876635 (+)	1803	WP_002263293.1	ABC transporter ATP-binding protein	Regulator
NPS18_RS04330 (NPS18_04330)	rcrQ	876625..878379 (+)	1755	WP_002263294.1	ABC transporter ATP-binding protein	Regulator

Sequence

Protein

• Length: 144 a.a.
• Molecular weight: 16720.58 Da
• Isoelectric Point: 10.5126

>NTDB_id=713496 NPS18_RS04320 WP_002263292.1 874395..874829(+) (rcrR) [Streptococcus mutans strain UA-159]
MKEPFSEFKNLITATERYIQELSKSHGVEHLSGPQGWTVMFLKDNQGKEIFIKDIEKRLDISKSVTSNLIKRMEKNGFIS
VIPSRKDRRYKQIVLTPLGQEKAGKITVFLTDLKKLLLKDISQEDLSVARKVFKQIKQNLEKKE

Nucleotide

• Length: 435 bp

>NTDB_id=713496 NPS18_RS04320 WP_002263292.1 874395..874829(+) (rcrR) [Streptococcus mutans strain UA-159]
ATGAAGGAGCCTTTTAGTGAATTTAAAAACCTCATTACAGCAACAGAAAGATATATTCAAGAATTATCCAAAAGCCATGG
TGTTGAACATCTGTCCGGACCTCAGGGATGGACAGTTATGTTTTTAAAGGATAATCAAGGAAAGGAAATTTTTATTAAAG
ATATTGAAAAAAGGTTAGATATCTCAAAATCTGTGACCAGTAATCTCATTAAACGAATGGAAAAAAATGGTTTTATTTCT
GTTATTCCTTCCAGAAAAGACAGACGATACAAGCAAATTGTTTTAACGCCATTAGGTCAGGAAAAAGCTGGAAAAATAAC
TGTTTTTTTAACAGATCTTAAAAAGTTGCTTCTAAAAGATATTAGTCAGGAAGACTTATCAGTTGCTCGGAAGGTTTTTA
AACAAATCAAACAAAATTTAGAAAAGAAGGAGTAA

Domains

Predicted by InterproScan.

• MarR family (MarR_2) (31-89)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
rcrR	Streptococcus mutans UA159	100	100	1