Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | NP434_RS12265 | Genome accession | NZ_CP101936 |
| Coordinates | 2420316..2420489 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain BGSC 10A5 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2415316..2425489
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP434_RS12250 (NP434_12250) | gcvT | 2416115..2417203 (-) | 1089 | WP_129092523.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NP434_RS12255 (NP434_12255) | hepAA | 2417645..2419318 (+) | 1674 | WP_085186487.1 | DEAD/DEAH box helicase | - |
| NP434_RS12260 (NP434_12260) | yqhG | 2419339..2420133 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| NP434_RS12265 (NP434_12265) | sinI | 2420316..2420489 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| NP434_RS12270 (NP434_12270) | sinR | 2420523..2420858 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| NP434_RS12275 (NP434_12275) | tasA | 2420951..2421736 (-) | 786 | WP_212130175.1 | biofilm matrix protein TasA | - |
| NP434_RS12280 (NP434_12280) | sipW | 2421800..2422372 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| NP434_RS12285 (NP434_12285) | tapA | 2422356..2423117 (-) | 762 | WP_015251716.1 | amyloid fiber anchoring/assembly protein TapA | - |
| NP434_RS12290 (NP434_12290) | yqzG | 2423389..2423715 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| NP434_RS12295 (NP434_12295) | spoIITA | 2423757..2423936 (-) | 180 | WP_029726723.1 | YqzE family protein | - |
| NP434_RS12300 (NP434_12300) | comGG | 2424008..2424382 (-) | 375 | WP_167408283.1 | ComG operon protein ComGG | Machinery gene |
| NP434_RS12305 (NP434_12305) | comGF | 2424383..2424766 (-) | 384 | WP_032726158.1 | ComG operon protein ComGF | Machinery gene |
| NP434_RS12310 (NP434_12310) | comGE | 2424792..2425139 (-) | 348 | WP_021480020.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=713238 NP434_RS12265 WP_003230187.1 2420316..2420489(+) (sinI) [Bacillus subtilis subsp. subtilis strain BGSC 10A5]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=713238 NP434_RS12265 WP_003230187.1 2420316..2420489(+) (sinI) [Bacillus subtilis subsp. subtilis strain BGSC 10A5]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |