Detailed information    

insolico Bioinformatically predicted

Overview


Name   comZ   Type   Regulator
Locus tag   NP434_RS06130 Genome accession   NZ_CP101936
Coordinates   1177941..1178132 (+) Length   63 a.a.
NCBI ID   WP_003224559.1    Uniprot ID   G4NWD2
Organism   Bacillus subtilis subsp. subtilis strain BGSC 10A5     
Function   repression of comG operon (predicted from homology)   
Competence regulation

Genomic Context


Location: 1172941..1183132
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP434_RS06100 (NP434_06100) argF 1173806..1174765 (+) 960 WP_088325579.1 ornithine carbamoyltransferase -
  NP434_RS06105 (NP434_06105) yjzC 1174851..1175030 (+) 180 WP_003245356.1 YjzC family protein -
  NP434_RS06110 (NP434_06110) yjzD 1175076..1175261 (-) 186 WP_003245236.1 YjzD family protein -
  NP434_RS06115 (NP434_06115) - 1175510..1176244 (+) 735 WP_003245223.1 hypothetical protein -
  NP434_RS06120 (NP434_06120) - 1176326..1176883 (+) 558 WP_015252365.1 hypothetical protein -
  NP434_RS06125 (NP434_06125) med 1176973..1177926 (+) 954 WP_014476425.1 transcriptional regulator Med Regulator
  NP434_RS06130 (NP434_06130) comZ 1177941..1178132 (+) 192 WP_003224559.1 ComG operon transcriptional repressor ComZ Regulator
  NP434_RS06135 (NP434_06135) yjzB 1178162..1178401 (-) 240 WP_003232972.1 spore coat protein YjzB -
  NP434_RS06140 (NP434_06140) fabH 1178566..1179504 (+) 939 WP_003232971.1 beta-ketoacyl-ACP synthase III -
  NP434_RS06145 (NP434_06145) fabF 1179527..1180768 (+) 1242 WP_003244890.1 beta-ketoacyl-ACP synthase II -
  NP434_RS06150 (NP434_06150) yjaZ 1180844..1181629 (+) 786 WP_014479439.1 DUF2268 domain-containing protein -
  NP434_RS06155 (NP434_06155) appD 1181821..1182807 (+) 987 WP_003232965.1 oligopeptide ABC transporter ATP-binding protein AppD -

Sequence


Protein


Download         Length: 63 a.a.        Molecular weight: 7214.27 Da        Isoelectric Point: 4.2564

>NTDB_id=713220 NP434_RS06130 WP_003224559.1 1177941..1178132(+) (comZ) [Bacillus subtilis subsp. subtilis strain BGSC 10A5]
MQHEKSLEFLQIAMKYLPEAKEQLEKSGIELSMEAIQPFMNLFTTVMAEAYELGKSDAKSETE

Nucleotide


Download         Length: 192 bp        

>NTDB_id=713220 NP434_RS06130 WP_003224559.1 1177941..1178132(+) (comZ) [Bacillus subtilis subsp. subtilis strain BGSC 10A5]
ATGCAGCACGAAAAATCACTTGAATTCTTGCAAATTGCCATGAAATATCTCCCTGAAGCGAAAGAACAGCTTGAGAAATC
AGGCATTGAGCTCTCAATGGAGGCCATCCAGCCGTTTATGAATCTATTTACAACGGTAATGGCGGAAGCTTATGAGCTTG
GCAAGTCTGACGCTAAATCTGAAACAGAATAA

Domains


Predicted by InterproScan.

(4-58)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4NWD2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Bacillus subtilis subsp. subtilis str. 168

100

100

1