Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NP436_RS16245 Genome accession   NZ_CP101932
Coordinates   3024852..3024992 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. natto strain BGSC 27E1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3019852..3029992
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP436_RS16220 (NP436_16220) - 3020050..3021297 (+) 1248 WP_031600262.1 IS256-like element ISBsu2 family transposase -
  NP436_RS16225 (NP436_16225) - 3021289..3022143 (-) 855 WP_256682815.1 hypothetical protein -
  NP436_RS16230 (NP436_16230) comX 3022159..3022380 (-) 222 WP_014480704.1 competence pheromone ComX -
  NP436_RS16235 (NP436_16235) - 3022538..3023669 (+) 1132 Protein_3129 IS4-like element IS4Bsu1 family transposase -
  NP436_RS16240 (NP436_16240) - 3023792..3024667 (-) 876 WP_131121720.1 polyprenyl synthetase family protein -
  NP436_RS16245 (NP436_16245) degQ 3024852..3024992 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NP436_RS16250 (NP436_16250) - 3025214..3025339 (+) 126 WP_003228793.1 hypothetical protein -
  NP436_RS16255 (NP436_16255) - 3025453..3025821 (+) 369 WP_014477834.1 hypothetical protein -
  NP436_RS16260 (NP436_16260) pdeH 3025797..3027026 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  NP436_RS16265 (NP436_16265) pncB 3027162..3028634 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  NP436_RS16270 (NP436_16270) pncA 3028650..3029201 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  NP436_RS16275 (NP436_16275) yueI 3029298..3029696 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=713183 NP436_RS16245 WP_003220708.1 3024852..3024992(-) (degQ) [Bacillus subtilis subsp. natto strain BGSC 27E1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=713183 NP436_RS16245 WP_003220708.1 3024852..3024992(-) (degQ) [Bacillus subtilis subsp. natto strain BGSC 27E1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1