Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   NP436_RS13260 Genome accession   NZ_CP101932
Coordinates   2458613..2459023 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis subsp. natto strain BGSC 27E1     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2451717..2490145 2458613..2459023 within 0


Gene organization within MGE regions


Location: 2451717..2490145
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP436_RS13220 (NP436_13220) yqeH 2451717..2452817 (-) 1101 WP_003229966.1 ribosome biogenesis GTPase YqeH -
  NP436_RS13225 (NP436_13225) yqeG 2452821..2453339 (-) 519 WP_003226126.1 YqeG family HAD IIIA-type phosphatase -
  NP436_RS13230 (NP436_13230) - 2453701..2453841 (+) 141 WP_003226124.1 sporulation histidine kinase inhibitor Sda -
  NP436_RS13235 (NP436_13235) yqeF 2454147..2454878 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  NP436_RS13240 (NP436_13240) cwlH 2455130..2455882 (-) 753 WP_014480318.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  NP436_RS13245 (NP436_13245) yqeD 2456069..2456695 (+) 627 WP_014480319.1 TVP38/TMEM64 family protein -
  NP436_RS13250 (NP436_13250) gnd 2456714..2457607 (-) 894 WP_014480320.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  NP436_RS13255 (NP436_13255) yqeB 2457858..2458580 (+) 723 WP_014480321.1 hypothetical protein -
  NP436_RS13260 (NP436_13260) nucA/comI 2458613..2459023 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  NP436_RS13265 (NP436_13265) sigK 2459219..2459947 (+) 729 WP_013308023.1 RNA polymerase sporulation sigma factor SigK -
  NP436_RS13270 (NP436_13270) - 2459947..2460045 (+) 99 WP_031600702.1 hypothetical protein -
  NP436_RS13275 (NP436_13275) - 2460042..2460254 (-) 213 Protein_2567 recombinase family protein -
  NP436_RS13280 (NP436_13280) fumC 2460473..2461861 (-) 1389 WP_014480325.1 class II fumarate hydratase -
  NP436_RS13285 (NP436_13285) - 2462028..2462918 (+) 891 WP_014480326.1 LysR family transcriptional regulator -
  NP436_RS13290 (NP436_13290) - 2463860..2464255 (+) 396 WP_014480327.1 VOC family protein -
  NP436_RS13300 (NP436_13300) - 2464995..2466122 (-) 1128 WP_014480328.1 Rap family tetratricopeptide repeat protein -
  NP436_RS22110 (NP436_13305) - 2466304..2467137 (+) 834 Protein_2572 ribonuclease YeeF family protein -
  NP436_RS22115 (NP436_13310) - 2467523..2468230 (+) 708 WP_014480330.1 hypothetical protein -
  NP436_RS13315 (NP436_13315) - 2468244..2468531 (+) 288 WP_014480331.1 hypothetical protein -
  NP436_RS13320 (NP436_13320) - 2468934..2469374 (+) 441 WP_014480332.1 SMI1/KNR4 family protein -
  NP436_RS13325 (NP436_13325) - 2469473..2469925 (+) 453 WP_014480333.1 SMI1/KNR4 family protein -
  NP436_RS13330 (NP436_13330) cdiI 2470022..2470381 (+) 360 WP_014480334.1 ribonuclease toxin immunity protein CdiI -
  NP436_RS13335 (NP436_13335) - 2470486..2470965 (+) 480 WP_224588637.1 hypothetical protein -
  NP436_RS13340 (NP436_13340) - 2471121..2472368 (+) 1248 WP_031600262.1 IS256-like element ISBsu2 family transposase -
  NP436_RS13345 (NP436_13345) - 2472650..2472853 (-) 204 WP_123772462.1 hypothetical protein -
  NP436_RS13350 (NP436_13350) - 2472942..2473175 (+) 234 WP_224588641.1 hypothetical protein -
  NP436_RS13355 (NP436_13355) atxG 2473443..2474020 (+) 578 Protein_2582 suppressor of fused domain protein -
  NP436_RS13360 (NP436_13360) - 2474130..2474420 (+) 291 WP_014480337.1 contact-dependent growth inhibition system immunity protein -
  NP436_RS13365 (NP436_13365) istA 2475261..2476808 (+) 1548 WP_014480339.1 IS21 family transposase -
  NP436_RS13370 (NP436_13370) istB 2476805..2477563 (+) 759 WP_014479891.1 IS21-like element helper ATPase IstB -
  NP436_RS22120 - 2477815..2477981 (-) 167 Protein_2586 peptidoglycan-binding protein -
  NP436_RS13380 (NP436_13380) - 2478156..2478242 (+) 87 WP_072592549.1 putative holin-like toxin -
  NP436_RS22125 - 2478529..2479004 (-) 476 Protein_2588 phage tail tube protein -
  NP436_RS13395 (NP436_13395) terS 2478964..2479528 (-) 565 Protein_2589 phage terminase small subunit -
  NP436_RS13400 (NP436_13400) - 2479655..2479960 (+) 306 WP_123772463.1 hypothetical protein -
  NP436_RS13410 (NP436_13410) - 2480353..2480832 (-) 480 WP_014480344.1 hypothetical protein -
  NP436_RS13415 (NP436_13415) - 2481449..2481715 (+) 267 WP_033881358.1 hypothetical protein -
  NP436_RS13420 (NP436_13420) - 2481854..2482006 (-) 153 WP_049832653.1 XtrA/YqaO family protein -
  NP436_RS13425 (NP436_13425) - 2482089..2482211 (-) 123 Protein_2594 RusA family crossover junction endodeoxyribonuclease -
  NP436_RS13430 (NP436_13430) - 2482174..2482422 (-) 249 Protein_2595 hypothetical protein -
  NP436_RS13435 (NP436_13435) - 2482567..2482797 (-) 231 WP_224588644.1 hypothetical protein -
  NP436_RS13440 (NP436_13440) - 2483106..2483286 (-) 181 Protein_2597 hypothetical protein -
  NP436_RS13445 (NP436_13445) bltR 2483494..2484315 (-) 822 WP_014480349.1 multidrug efflux transcriptional regulator BltR -
  NP436_RS13450 (NP436_13450) blt 2484432..2485634 (+) 1203 WP_014480350.1 multidrug efflux MFS transporter Blt -
  NP436_RS13455 (NP436_13455) bltD 2485816..2486274 (+) 459 WP_014480351.1 spermine/spermidine acetyltransferase -
  NP436_RS13460 (NP436_13460) yrkA 2486433..2487737 (-) 1305 WP_014480352.1 hemolysin family protein -
  NP436_RS13465 (NP436_13465) yrzO 2488027..2488170 (-) 144 WP_014477437.1 YrzO family protein -
  NP436_RS13470 (NP436_13470) yrdR 2488188..2489153 (-) 966 WP_014480354.1 DMT family transporter -
  NP436_RS13475 (NP436_13475) czcR 2489279..2490145 (+) 867 WP_014480355.1 LysR family transcriptional regulator CzcR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=713173 NP436_RS13260 WP_009967785.1 2458613..2459023(-) (nucA/comI) [Bacillus subtilis subsp. natto strain BGSC 27E1]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=713173 NP436_RS13260 WP_009967785.1 2458613..2459023(-) (nucA/comI) [Bacillus subtilis subsp. natto strain BGSC 27E1]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529