Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   NP447_RS15090 Genome accession   NZ_CP101920
Coordinates   3105908..3106537 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain QA-1986 630     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3082594..3121999 3105908..3106537 within 0


Gene organization within MGE regions


Location: 3082594..3121999
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP447_RS24900 - 3083083..3083406 (-) 324 Protein_2935 hypothetical protein -
  NP447_RS14920 (NP447_14920) - 3083584..3083709 (-) 126 Protein_2936 hypothetical protein -
  NP447_RS14925 (NP447_14925) - 3083720..3083983 (-) 264 WP_021527607.1 hypothetical protein -
  NP447_RS14930 (NP447_14930) - 3083985..3084476 (-) 492 WP_021529587.1 XF1762 family protein -
  NP447_RS14935 (NP447_14935) - 3084479..3084955 (-) 477 WP_021529588.1 hypothetical protein -
  NP447_RS14940 (NP447_14940) - 3085051..3085407 (-) 357 WP_021527610.1 hypothetical protein -
  NP447_RS14945 (NP447_14945) - 3085465..3085887 (-) 423 WP_021529589.1 DUF977 family protein -
  NP447_RS14950 (NP447_14950) - 3085903..3086673 (-) 771 WP_096951112.1 DUF1627 domain-containing protein -
  NP447_RS14955 (NP447_14955) - 3086696..3087169 (-) 474 WP_249548345.1 replication protein P -
  NP447_RS14960 (NP447_14960) - 3087162..3088202 (-) 1041 WP_122985536.1 DnaT-like ssDNA-binding domain-containing protein -
  NP447_RS14965 (NP447_14965) - 3088274..3088699 (-) 426 WP_000693853.1 toxin YdaT family protein -
  NP447_RS14970 (NP447_14970) - 3088696..3088923 (-) 228 WP_001261754.1 Cro/CI family transcriptional regulator -
  NP447_RS14975 (NP447_14975) - 3089023..3089667 (+) 645 WP_000444613.1 LexA family transcriptional regulator -
  NP447_RS14980 (NP447_14980) ydfA 3089944..3090099 (+) 156 WP_000379575.1 DUF1391 family protein -
  NP447_RS14985 (NP447_14985) ydfB 3090101..3090229 (+) 129 WP_000344964.1 protein YdfB -
  NP447_RS14990 (NP447_14990) ydfC 3090259..3090477 (+) 219 WP_047654499.1 protein YdfC -
  NP447_RS14995 (NP447_14995) - 3090500..3090820 (+) 321 WP_000394534.1 hypothetical protein -
  NP447_RS15000 (NP447_15000) - 3090798..3091073 (-) 276 WP_000102678.1 hypothetical protein -
  NP447_RS15005 (NP447_15005) dicB 3091635..3091823 (+) 189 WP_000854564.1 cell division inhibition protein DicB -
  NP447_RS15010 (NP447_15010) - 3091820..3092008 (+) 189 WP_001070253.1 DUF1482 family protein -
  NP447_RS24905 - 3092102..3094543 (+) 2442 WP_047662844.1 exonuclease -
  NP447_RS15025 (NP447_15025) - 3094610..3094861 (+) 252 WP_040088437.1 DUF4224 domain-containing protein -
  NP447_RS15030 (NP447_15030) - 3094830..3095849 (+) 1020 WP_074148211.1 tyrosine-type recombinase/integrase -
  NP447_RS15035 (NP447_15035) yccA 3096257..3096916 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  NP447_RS15040 (NP447_15040) tusE 3097007..3097336 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  NP447_RS15045 (NP447_15045) yccX 3097333..3097611 (-) 279 WP_000048234.1 acylphosphatase -
  NP447_RS15050 (NP447_15050) rlmI 3097706..3098896 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  NP447_RS15055 (NP447_15055) hspQ 3098954..3099271 (+) 318 WP_001295356.1 heat shock protein HspQ -
  NP447_RS15060 (NP447_15060) yccU 3099316..3099729 (-) 414 WP_000665217.1 CoA-binding protein -
  NP447_RS15065 (NP447_15065) yccT 3099902..3100564 (+) 663 WP_000847785.1 DUF2057 family protein -
  NP447_RS15070 (NP447_15070) mgsA 3100660..3101118 (+) 459 WP_000424181.1 methylglyoxal synthase -
  NP447_RS15075 (NP447_15075) helD 3101150..3103204 (-) 2055 WP_000420536.1 DNA helicase IV -
  NP447_RS15080 (NP447_15080) yccF 3103327..3103773 (+) 447 WP_001261235.1 YccF domain-containing protein -
  NP447_RS15085 (NP447_15085) yccS 3103783..3105945 (+) 2163 WP_000875019.1 YccS family putative transporter -
  NP447_RS15090 (NP447_15090) sxy/tfoX 3105908..3106537 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  NP447_RS15095 (NP447_15095) sulA 3106756..3107265 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  NP447_RS15100 (NP447_15100) ompA 3107622..3108674 (+) 1053 WP_000750419.1 porin OmpA -
  NP447_RS15105 (NP447_15105) matP 3108749..3109201 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  NP447_RS15110 (NP447_15110) ycbZ 3109387..3111147 (+) 1761 WP_000156526.1 Lon protease family protein -
  NP447_RS15115 (NP447_15115) fabA 3111216..3111734 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  NP447_RS15120 (NP447_15120) rmf 3111804..3111971 (-) 168 WP_000828648.1 ribosome modulation factor -
  NP447_RS15125 (NP447_15125) pqiC 3112227..3112790 (-) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  NP447_RS15130 (NP447_15130) pqiB 3112787..3114427 (-) 1641 WP_000445533.1 intermembrane transport protein PqiB -
  NP447_RS15135 (NP447_15135) pqiA 3114432..3115685 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  NP447_RS15140 (NP447_15140) uup 3115815..3117722 (-) 1908 WP_000053089.1 ABC transporter ATP-binding protein -
  NP447_RS15145 (NP447_15145) rlmKL 3117733..3119841 (-) 2109 WP_001086517.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  NP447_RS15150 (NP447_15150) ycbX 3120085..3121194 (+) 1110 WP_000258204.1 6-N-hydroxylaminopurine resistance protein YcbX -
  NP447_RS15155 (NP447_15155) zapC 3121191..3121733 (-) 543 WP_001295353.1 cell division protein ZapC -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=712890 NP447_RS15090 WP_000839153.1 3105908..3106537(-) (sxy/tfoX) [Escherichia coli strain QA-1986 630]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=712890 NP447_RS15090 WP_000839153.1 3105908..3106537(-) (sxy/tfoX) [Escherichia coli strain QA-1986 630]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1