Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NNG64_RS15350 Genome accession   NZ_CP101610
Coordinates   3096721..3096861 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus siamensis strain WYJ-E14     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3091721..3101861
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NNG64_RS15325 (NNG64_15280) - 3092048..3092431 (-) 384 WP_060964423.1 hotdog fold thioesterase -
  NNG64_RS15330 (NNG64_15285) comA 3092453..3093097 (-) 645 WP_016938117.1 response regulator transcription factor Regulator
  NNG64_RS15335 (NNG64_15290) comP 3093178..3095484 (-) 2307 WP_060964422.1 sensor histidine kinase Regulator
  NNG64_RS15340 (NNG64_15295) comX 3095503..3095679 (-) 177 WP_044052947.1 competence pheromone ComX -
  NNG64_RS15345 (NNG64_15300) - 3095694..3096569 (-) 876 WP_060965112.1 polyprenyl synthetase family protein -
  NNG64_RS15350 (NNG64_15305) degQ 3096721..3096861 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  NNG64_RS15355 (NNG64_15310) - 3097327..3097668 (+) 342 WP_060964421.1 hypothetical protein -
  NNG64_RS15360 (NNG64_15315) - 3097673..3098896 (-) 1224 WP_060964420.1 EAL and HDOD domain-containing protein -
  NNG64_RS15365 (NNG64_15320) - 3099026..3100492 (-) 1467 WP_101605399.1 nicotinate phosphoribosyltransferase -
  NNG64_RS15370 (NNG64_15325) - 3100510..3101061 (-) 552 WP_060964419.1 cysteine hydrolase family protein -
  NNG64_RS15375 (NNG64_15330) - 3101150..3101548 (-) 399 WP_060964418.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=710884 NNG64_RS15350 WP_013353398.1 3096721..3096861(-) (degQ) [Bacillus siamensis strain WYJ-E14]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=710884 NNG64_RS15350 WP_013353398.1 3096721..3096861(-) (degQ) [Bacillus siamensis strain WYJ-E14]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCTTTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913