Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   NMK62_RS17380 Genome accession   NZ_CP101310
Coordinates   3408393..3409022 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain 99-3311     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3392397..3420210 3408393..3409022 within 0


Gene organization within MGE regions


Location: 3392397..3420210
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NMK62_RS17300 (NMK62_17300) dicB 3394122..3394310 (+) 189 WP_000413705.1 cell division inhibition protein DicB -
  NMK62_RS17305 (NMK62_17305) - 3394307..3394498 (+) 192 WP_001098307.1 DUF1482 family protein -
  NMK62_RS17310 (NMK62_17310) - 3394592..3397027 (+) 2436 WP_025380290.1 exonuclease -
  NMK62_RS17315 (NMK62_17315) - 3397095..3397337 (+) 243 WP_000273151.1 DUF4224 domain-containing protein -
  NMK62_RS17320 (NMK62_17320) - 3397315..3398334 (+) 1020 WP_001299351.1 tyrosine-type recombinase/integrase -
  NMK62_RS17325 (NMK62_17325) yccA 3398742..3399401 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  NMK62_RS17330 (NMK62_17330) tusE 3399492..3399821 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  NMK62_RS17335 (NMK62_17335) yccX 3399818..3400096 (-) 279 WP_000048228.1 acylphosphatase -
  NMK62_RS17340 (NMK62_17340) rlmI 3400191..3401381 (+) 1191 WP_000116291.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  NMK62_RS17345 (NMK62_17345) hspQ 3401439..3401756 (+) 318 WP_001295356.1 heat shock protein HspQ -
  NMK62_RS17350 (NMK62_17350) yccU 3401801..3402214 (-) 414 WP_000665217.1 CoA-binding protein -
  NMK62_RS17355 (NMK62_17355) yccT 3402387..3403049 (+) 663 WP_000847791.1 DUF2057 family protein -
  NMK62_RS17360 (NMK62_17360) mgsA 3403145..3403603 (+) 459 WP_000424181.1 methylglyoxal synthase -
  NMK62_RS17365 (NMK62_17365) helD 3403635..3405689 (-) 2055 WP_000420536.1 DNA helicase IV -
  NMK62_RS17370 (NMK62_17370) yccF 3405812..3406258 (+) 447 WP_001261235.1 YccF domain-containing protein -
  NMK62_RS17375 (NMK62_17375) yccS 3406268..3408430 (+) 2163 WP_000875041.1 YccS family putative transporter -
  NMK62_RS17380 (NMK62_17380) sxy/tfoX 3408393..3409022 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  NMK62_RS17385 (NMK62_17385) sulA 3409241..3409750 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  NMK62_RS17390 (NMK62_17390) ompA 3410107..3411162 (+) 1056 WP_000750414.1 porin OmpA -
  NMK62_RS17395 (NMK62_17395) matP 3411237..3411689 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  NMK62_RS17400 (NMK62_17400) ycbZ 3411875..3413635 (+) 1761 WP_000156509.1 Lon protease family protein -
  NMK62_RS17405 (NMK62_17405) fabA 3413704..3414222 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  NMK62_RS17410 (NMK62_17410) rmf 3414292..3414459 (-) 168 WP_000828648.1 ribosome modulation factor -
  NMK62_RS17415 (NMK62_17415) pqiC 3414715..3415278 (-) 564 WP_000759123.1 membrane integrity-associated transporter subunit PqiC -
  NMK62_RS17420 (NMK62_17420) pqiB 3415275..3416915 (-) 1641 WP_000445542.1 intermembrane transport protein PqiB -
  NMK62_RS17425 (NMK62_17425) pqiA 3416920..3418173 (-) 1254 WP_000333170.1 membrane integrity-associated transporter subunit PqiA -
  NMK62_RS17430 (NMK62_17430) uup 3418303..3420210 (-) 1908 WP_000053100.1 ABC transporter ATP-binding protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=709608 NMK62_RS17380 WP_000839153.1 3408393..3409022(-) (sxy/tfoX) [Escherichia coli strain 99-3311]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=709608 NMK62_RS17380 WP_000839153.1 3408393..3409022(-) (sxy/tfoX) [Escherichia coli strain 99-3311]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGTAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1